KEGG   Sus scrofa (pig): 403331Help
Entry
403331            CDS       T01009                                 

Gene name
CYP19A1
Definition
cytochrome P450 19A1 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    403331 (CYP19A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    403331 (CYP19A1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     403331 (CYP19A1)
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP19 family
   403331 (CYP19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 503 aa AA seqDB search
MVLEMLNPMHYKVTSMVSEVVPFASIAVLLLTGFLLLVWNYKNTSSIPGPGYFLGIGPLI
SYLRFLWMGIGSACNYYNKTYGEFIRVWIGGEETLIISKSSSVFHVMKHSHYTSRFGSKP
GLQFIGMHEKGIIFNNNPVLWKAVRTYFMKALSGPGLVRMVTVCADSITKHLDKLEEVRN
DLGYVDVLTLMRRIMLDTSNNLFLGIPLDEKAIVCKIQGYFDAWQALLLKPDIFFKIPWL
YRKYEKSVKDLKEDMEILIEKKRRRIFTAEKLEDCMDFATELILAEKRGELTKENVNQCI
LEMLIAAPDTMSVTVFFMLFLIAKHPQVEEELMKEIQTVVGERDIRNDDMQKLEVVENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRACAGKYIAMVMMKVTLVILLRRFQVQTPQDRCVEKMQKKNDLSLH
PDETSGLLEMIFIPRNSDKCFTK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttttggaaatgctgaacccaatgcattataaagtcaccagcatggtgtctgaagtt
gtgccttttgccagcattgcagtcctgctgctcactggctttcttctcttggtttggaat
tataaaaacacatcttcaataccaggtcctggctattttctgggaattgggcccctaatt
tcctacctcagattcctctggatggggattggcagtgcctgcaactactacaacaaaacg
tatggagaattcataagagtctggataggtggagaagaaacactcattattagcaagtcc
tcaagtgtgttccatgtaatgaagcatagtcactacacatcccgatttggcagcaaacct
gggttgcagttcattggcatgcatgagaaaggcattatattcaacaataatccagtcctc
tggaaagctgttagaacttattttatgaaagctctgtccggccctggcctggtgcgcatg
gtgaccgtctgtgccgattccatcaccaagcacctggacaagctggaggaggtccgcaat
gacttgggctacgtggacgtgttgaccctcatgcggcgcatcatgctggacacctctaac
aacctcttcctggggatcccactggacgaaaaggccattgtgtgtaaaatccagggttat
tttgatgcatggcaagctctccttctcaaaccagacatcttctttaagattccttggctg
tacagaaagtatgaaaagtctgtaaaggatttgaaagaggacatggaaattctgatagaa
aaaaaaagacgcaggattttcacagcagaaaaactggaagactgcatggatttcgccact
gagttgattttggctgagaaacgtggtgaactgacaaaagagaatgtgaaccagtgcata
ctggaaatgctaattgcagcaccagacaccatgtctgtcactgtgttcttcatgctgttt
ctcattgcaaagcacccccaggttgaagaggaactaatgaaggaaatccagactgttgtt
ggtgaaagagacataaggaatgatgacatgcaaaaactcgaagtggtggaaaactttatt
tatgagagcatgaggtaccagcctgtcgtggacctcgtcatgcgaaaagccttagaggat
gatgtcatcgatggctacccggtgaaaaagggaaccaacattatcctgaatattggaaga
atgcatagactcgagtttttccccaagcccaatgaatttactcttgagaactttgccaag
aatgttccttacaggtacttccagccatttggctttgggccccgggcctgtgcgggaaag
tatatcgccatggtcatgatgaaggtcactctggtcatacttctgagacgcttccaagtg
cagacaccgcaagaccggtgtgttgaaaagatgcagaagaaaaatgatttatccttgcac
ccggatgagaccagcggcctgctggaaatgattttcatcccaagaaattcagacaagtgt
ttcactaaataa

DBGET integrated database retrieval system