KEGG   Sus scrofa (pig): 403333Help
Entry
403333            CDS       T01009                                 

Gene name
CYP19A3
Definition
cytochrome P450 19A3 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ssc00140]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:ssc04913]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 501 aa AA seqDB search
MVLEMLNPMNISSMVSEAVLFGSIAILLLIGLLLWVWNYEDTSSIPGPGYFLGIGPLISH
FRFLWMGIGSACNYYNKMYGEFMRVWIGGEETLIISKSSSIFHIMKHNHYTCRFGSKLGL
ECIGMHEKGIMFNNNPALWKAVRPFFTKALSGPGLVRMVTVCADSITKHLDKLEEVRNDL
GYVDVLTLMRRIMLDTSNNLFLGIPLDESALVHKVQGYFDAWQALLLKPDIFFKISWLYR
KYEKSVKDLKDAMEILIEEKRHRISTAEKLEDSMDFTTQLIFAEKRGELTKENVNQCVLE
MMIAAPDTMSITVFFMLFLIANHPQVEEELMKEIYTVVGERDIRNDDMQKLKVVENFIYE
SMRYQPVVDFVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAKNV
PYRYFQPFGFGPRACAGKYIAMVMMKVILVTLLRRFQVQTQQGQCVEKMQKKNDLSLHPH
ETSGLLEMIFIPRNSDKCLEH
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttttggaaatgctgaacccaatgaacatcagcagcatggtgtctgaagctgtcctt
tttggcagcattgcaatcctgctgctcattggcttacttctctgggtttggaattatgag
gacacatcctcaataccaggtcctggctattttctgggaattgggcccctcatttcccac
ttcaggttcctctggatggggattggcagtgcctgcaactactacaacaaaatgtatgga
gaattcatgagggtctggataggtggagaggaaacactcattattagcaagtcttcaagt
attttccacataatgaagcacaatcattacacgtgccgatttggcagcaaacttgggttg
gaatgcattggcatgcatgaaaaaggcatcatgtttaacaataatccagccctctggaaa
gctgttcgacctttctttacaaaagctctgtccggccctggcctggtgcgcatggtgacc
gtctgtgccgattccatcaccaagcacctggacaagctggaggaggtccgcaatgacttg
ggctacgtggacgtgttgaccctcatgcggcgcatcatgctggacacctctaacaacctc
ttcctggggatcccattggacgaaagtgccctcgtgcataaagtccagggttattttgat
gcatggcaagctctccttctcaaaccagacatcttctttaagatttcttggctgtacaga
aagtatgaaaagtctgtcaaggatttgaaagacgccatggaaattctaatagaagaaaaa
agacacaggatttcaacagcagagaaactggaagactctatggatttcaccactcagttg
atttttgctgagaaacgtggcgaattaacaaaggagaatgtgaaccagtgcgtactggaa
atgatgattgcagcgccagacaccatgtctatcactgtgttcttcatgctgtttctcatt
gcaaatcacccccaggttgaagaggaactaatgaaggaaatctacactgttgttggtgag
agagacataaggaatgatgacatgcaaaaactcaaagtggtggaaaactttatttatgag
agcatgaggtaccagcctgtcgtggacttcgtcatgcgaaaagccttagaggatgatgtc
atcgatggctacccggtgaaaaagggaaccaacattatcctgaatattggaagaatgcat
agactcgagtttttccccaagcccaatgaatttactcttgagaactttgccaagaatgtt
ccttataggtacttccagccatttggctttgggccccgggcctgtgcgggaaagtatatc
gccatggtcatgatgaaggtcatcttggtcacacttctgagacgcttccaagtgcaaaca
cagcaaggccagtgtgttgaaaagatgcagaagaaaaatgacttatccctacacccacat
gagaccagcggcctgctggaaatgattttcatcccaagaaattcagacaagtgcctcgag
cactaa

DBGET integrated database retrieval system