KEGG   Sus scrofa (pig): 403337Help
Entry
403337            CDS       T01009                                 

Gene name
CYP21A2
Definition
(RefSeq) steroid 21-hydroxylase precursor
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    403337 (CYP21A2)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    403337 (CYP21A2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     403337 (CYP21A2)
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP21 family
   403337 (CYP21A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 492 aa AA seqDB search
MVLVWLLLLLTLLAGARLLWGQWKLRNLHLPPLVPGFLHLLQPNLPIYLLGLTQRLGPIY
RLRLGLQDVVVLNSKRTIEEALVRKWVDFAGRPQIPSYKLASQHCPDISLGDYSLFWKAH
KKLTRSALLLGVRSSMEPRVEQLTQEFCERMRAQAGTPVTIQKEFSVLTCSIICCLTFGD
KEDTLVHALHDCVQDLMKTWEHWSIQILDMVPFLRFFPSPGLRRLKQAIENRDHLVEKQL
RRHKESMVAGQWRDMLDYMLQEAGRQRVEEGQGQLLEGHVHMSVVDLFIGGTETTANTLS
WAVVYLLHHPEIQWRLQEELDRELGPGAAGSRVPYKDRARLPLLNATIAEVLRLRPVVPL
ALPHRATRPSSIFGYDIPEGTVVIPNLQGAHLDETVWEQPHEFRPDRFLAPGANPSALAF
GCGARVCLGEPLARLELFVVLVQLLQAFTLLPPEGALPSLQPHPHSGINLKVQPFQVRLQ
PRGGRGEGPGPR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgtatggctgctgctgctgctgaccctgctagcaggtgcacgcctgctgtgg
ggccagtggaagctcaggaacctccacctcccacctctggtgcccggcttcctgcacctg
ctgcagcccaacctccccatctatctgctcggcctgacgcagagactcgggcctatctac
aggctccgtctggggctgcaagatgtggtggtgctgaactccaagcggaccattgaggag
gccttggtcaggaagtgggtggactttgccggcagaccccagataccatcctacaagctg
gcgtctcagcactgccccgacatctcgctaggggactactccctgttctggaaggctcac
aagaaactcacccgctcagccctgctgctgggcgtccgcagctccatggagccccgggtg
gagcagctgacccaggagttctgtgagcgcatgagagcccaggcggggacccccgtgacc
atccagaaggaattctctgtcctcacctgcagcatcatctgttgcctcacctttggagac
aaggaggacaccttagtgcatgcccttcacgactgtgtccaggacctgatgaaaacctgg
gagcactggtccatccaaattttggacatggttccctttctcaggttcttccccagccct
ggcctccggaggctgaagcaggccatagagaacagggaccacctcgtggagaagcagctg
aggcggcacaaggagagcatggtggccggccagtggagggacatgctggactacatgctc
caggaggcggggaggcaaagagtggaagaggggcagggacagctcctggaagggcacgtg
cacatgtcggtggtggaccttttcattggtggcactgagaccacagcgaacaccctttcc
tgggctgtggtgtacctgcttcaccaccctgagattcagtggcggctgcaggaggagtta
gatcgtgagctgggccctggagctgcgggctcccgagtcccatacaaggaccgtgcccgg
ctgcctttgctcaacgccaccattgctgaggtgctgcgtctgcggcccgtggttcccctg
gccttgccacaccgagccactcggcctagcagcatcttcggctacgacatccctgagggc
accgttgtcatccccaacctccaaggtgcccacctggacgagacggtctgggagcagccg
cacgagttccggccagaccgcttcctggcccctggcgcgaaccccagtgcgctggccttt
ggctgcggggcgcgagtgtgcctgggggagccgctggcgcgcctcgagctcttcgtggtg
ctggtgcaactgctccaggccttcacgctgctgccgcccgagggcgccctgccttcgctg
cagccccatccgcacagtggcatcaacctcaaggtacagcctttccaggtgcggctgcag
ccccggggggggaggggcgaaggcccagggcccaggtga

DBGET integrated database retrieval system