KEGG   Sus scrofa (pig): 403337Help
Entry
403337            CDS       T01009                                 

Gene name
CYP21A2, CYP21
Definition
cytochrome P450, family 21, subfamily A, polypepide 2 (EC:1.14.99.10)
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ssc00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 492 aa AA seqDB search
MVLVWLLLLLTLLAGARLLWGQWKLRNLHLPPLVPGFLHLLQPNLPIYLLGLTQRLGPIY
RLRLGLQDVVVLNSKRTIEEALVRKWVDFAGRPQIPSYKLASQHCPDISLGDYSLFWKAH
KKLTRSALLLGVRSSMEPRVEQLTQEFCERMRAQAGTPVTIQKEFSVLTCSIICCLTFGD
KEDTLVHALHDCVQDLMKTWEHWSIQILDMVPFLRFFPSPGLRRLKQAIENRDHLVEKQL
RRHKESMVAGQWRDMLDYMLQEAGRQRVEEGQGQLLEGHVHMSVVDLFIGGTETTANTLS
WAVVYLLHHPEIQWRLQEELDRELGPGAAGSRVPYKDRARLPLLNATIAEVLRLRPVVPL
ALPHRATRPSSIFGYDIPEGTVVIPNLQGAHLDETVWEQPHEFRPDRFLAPGANPSALAF
GCGARVCLGEPLARLELFVVLVQLLQAFTLLPPEGALPSLQPHPHSGINLKVQPFQVRLQ
PRGGRGEGPGPR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgtatggctgctgctgctgctgaccctgctagcaggtgcacgcctgctgtgg
ggccagtggaagctcaggaacctccacctcccacctctggtgcccggcttcctgcacctg
ctgcagcccaacctccccatctatctgctcggcctgacgcagagactcgggcctatctac
aggctccgtctggggctgcaagatgtggtggtgctgaactccaagcggaccattgaggag
gccttggtcaggaagtgggtggactttgccggcagaccccagataccatcctacaagctg
gcgtctcagcactgccccgacatctcgctaggggactactccctgttctggaaggctcac
aagaaactcacccgctcagccctgctgctgggcgtccgcagctccatggagccccgggtg
gagcagctgacccaggagttctgtgagcgcatgagagcccaggcggggacccccgtgacc
atccagaaggaattctctgtcctcacctgcagcatcatctgttgcctcacctttggagac
aaggaggacaccttagtgcatgcccttcacgactgtgtccaggacctgatgaaaacctgg
gagcactggtccatccaaattttggacatggttccctttctcaggttcttccccagccct
ggcctccggaggctgaagcaggccatagagaacagggaccacctcgtggagaagcagctg
aggcggcacaaggagagcatggtggccggccagtggagggacatgctggactacatgctc
caggaggcggggaggcaaagagtggaagaggggcagggacagctcctggaagggcacgtg
cacatgtcggtggtggaccttttcattggtggcactgagaccacagcgaacaccctttcc
tgggctgtggtgtacctgcttcaccaccctgagattcagtggcggctgcaggaggagtta
gatcgtgagctgggccctggagctgcgggctcccgagtcccatacaaggaccgtgcccgg
ctgcctttgctcaacgccaccattgctgaggtgctgcgtctgcggcccgtggttcccctg
gccttgccacaccgagccactcggcctagcagcatcttcggctacgacatccctgagggc
accgttgtcatccccaacctccaaggtgcccacctggacgagacggtctgggagcagccg
cacgagttccggccagaccgcttcctggcccctggcgcgaaccccagtgcgctggccttt
ggctgcggggcgcgagtgtgcctgggggagccgctggcgcgcctcgagctcttcgtggtg
ctggtgcaactgctccaggccttcacgctgctgccgcccgagggcgccctgccttcgctg
cagccccatccgcacagtggcatcaacctcaaggtacagcctttccaggtgcggctgcag
ccccggggggggaggggcgaaggcccagggcccaggtga

DBGET integrated database retrieval system