KEGG   Sus scrofa (pig): 407745Help
Entry
407745            CDS       T01009                                 

Gene name
TYR
Definition
tyrosinase (oculocutaneous albinism IA) (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    407745 (TYR)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    407745 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    407745 (TYR)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     407745 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 531 aa AA seqDB search
MLLAALYCLLWTFQTSAGHFPRACASSKNLMEKECCPPWGGDGSPCGQLSGRGSCQDIIL
SKAPLGPQFPFTGVDERESWPSVFYNRTCQCFGNFMGFNCGSCKFGFQGPNCTERRLLVR
RNIFDLSVPEKNKFLAYLTLAKHTTSPDFVIPTGTYGQMNNGSTPMFSDINIYDLFVWMH
YYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLVWEQEIQKLTGDENFTIPYWDWRD
AENCDICTDEYMGGRNPANPNLLSPASFFSSWQIICSRLEEYNSRQALCNGTPEGPLLRN
PGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKSANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRKHHPLLEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSRDLGYDYSYLQDSEPDFFQDYIKPYLEQASRIWPWLLG
AAVVGSVLTAVLGGITRRLCCRRKRKRLPEEKQPLLMEKEDYDSLLYQSHL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctgctttgtactgcctgctctggactttccagacttccgccggacacttc
cctcgagcctgtgcctcctccaagaacctgatggagaaggaatgctgcccaccctgggga
ggtgatgggagtccctgtggccagctctcaggcaggggttcctgtcaggacatcattctg
tccaaggcacccctgggacctcagttccccttcaccggggtggatgaacgggagtcttgg
ccctccgtcttttacaacaggacctgccagtgctttggcaacttcatgggatttaactgt
ggaagttgtaagtttggctttcagggacccaactgcacagagaggcgacttttggtcaga
agaaacatctttgatttgagtgtgccagagaagaacaaatttcttgcctacctcacttta
gcgaaacatactaccagcccagacttcgtcatccccacaggcacctatggccaaatgaat
aatggatcaacacccatgtttagtgacatcaacatttatgacctctttgtctggatgcat
tattacgtgtctagggacacactacttgggggctctgaaatctggagagacattgatttt
gctcatgaagcaccaggtttcctgccttggcatcgactcttcttgctggtatgggaacaa
gaaatccagaagctgacaggggatgagaacttcactattccatactgggattggcgagat
gcagaaaattgtgacatttgcacagatgagtacatgggaggacgcaaccctgcaaaccct
aatctactcagcccagcatccttcttctcctcttggcagatcatctgcagccgactggag
gagtacaacagccgtcaggctttatgcaatgggactcccgagggacctctactgcgcaat
cctggaaaccacgacaaatccaggactccaaggctcccctcctcagccgatgtggaattt
tgcctgagtctgacccagtatgaatcaggttccatggataaatctgccaatttcagcttt
agaaatacactggaaggatttgctagcccactgactgggatagcagatgcctctcaaagc
agtatgcacaatgccctgcacatctacatgaatggaaccatgtcccaggtacagggctct
gccaacgatcccattttccttcttcatcatgcatttgttgacagtatttttgaacagtgg
cttcgaaagcaccaccctcttcttgaagtgtatccggaagccaatgcacccattggacac
aaccgggaatcttacatggttccatttatacctctctacagaaatggtgacttctttatt
tcatccagagatctaggctatgactacagctacctacaagattcagaaccggactttttt
caagattacattaagccctacttagaacaagcaagtaggatctggccatggctccttggg
gcagccgtggtagggtctgtcctcactgcggtgttgggaggaatcacaaggcggttatgt
tgtcgtcgaaagagaaagcggcttcctgaagaaaagcagccactccttatggaaaaggag
gattacgacagcttgttgtatcagagccatttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system