KEGG   Sus scrofa (pig): 407745Help
Entry
407745            CDS       T01009                                 

Gene name
TYR
Definition
(RefSeq) tyrosinase precursor
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00350  Tyrosine metabolism
ssc01100  Metabolic pathways
ssc04916  Melanogenesis
Module
ssc_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    407745 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    407745 (TYR)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     407745 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase UPF0126 Laminin_EGF
Motif
Other DBs
NCBI-GeneID: 407745
NCBI-ProteinID: NP_001020383
UniProt: Q4R1H3
Position
9
AA seq 531 aa AA seqDB search
MLLAALYCLLWTFQTSAGHFPRACASSKNLMEKECCPPWGGDGSPCGQLSGRGSCQDIIL
SKAPLGPQFPFTGVDERESWPSVFYNRTCQCFGNFMGFNCGSCKFGFQGPNCTERRLLVR
RNIFDLSVPEKNKFLAYLTLAKHTTSPDFVIPTGTYGQMNNGSTPMFSDINIYDLFVWMH
YYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLVWEQEIQKLTGDENFTIPYWDWRD
AENCDICTDEYMGGRNPANPNLLSPASFFSSWQIICSRLEEYNSRQALCNGTPEGPLLRN
PGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKSANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRKHHPLLEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSRDLGYDYSYLQDSEPDFFQDYIKPYLEQASRIWPWLLG
AAVVGSVLTAVLGGITRRLCCRRKRKRLPEEKQPLLMEKEDYDSLLYQSHL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctgctttgtactgcctgctctggactttccagacttccgccggacacttc
cctcgagcctgtgcctcctccaagaacctgatggagaaggaatgctgcccaccctgggga
ggtgatgggagtccctgtggccagctctcaggcaggggttcctgtcaggacatcattctg
tccaaggcacccctgggacctcagttccccttcaccggggtggatgaacgggagtcttgg
ccctccgtcttttacaacaggacctgccagtgctttggcaacttcatgggatttaactgt
ggaagttgtaagtttggctttcagggacccaactgcacagagaggcgacttttggtcaga
agaaacatctttgatttgagtgtgccagagaagaacaaatttcttgcctacctcacttta
gcgaaacatactaccagcccagacttcgtcatccccacaggcacctatggccaaatgaat
aatggatcaacacccatgtttagtgacatcaacatttatgacctctttgtctggatgcat
tattacgtgtctagggacacactacttgggggctctgaaatctggagagacattgatttt
gctcatgaagcaccaggtttcctgccttggcatcgactcttcttgctggtatgggaacaa
gaaatccagaagctgacaggggatgagaacttcactattccatactgggattggcgagat
gcagaaaattgtgacatttgcacagatgagtacatgggaggacgcaaccctgcaaaccct
aatctactcagcccagcatccttcttctcctcttggcagatcatctgcagccgactggag
gagtacaacagccgtcaggctttatgcaatgggactcccgagggacctctactgcgcaat
cctggaaaccacgacaaatccaggactccaaggctcccctcctcagccgatgtggaattt
tgcctgagtctgacccagtatgaatcaggttccatggataaatctgccaatttcagcttt
agaaatacactggaaggatttgctagcccactgactgggatagcagatgcctctcaaagc
agtatgcacaatgccctgcacatctacatgaatggaaccatgtcccaggtacagggctct
gccaacgatcccattttccttcttcatcatgcatttgttgacagtatttttgaacagtgg
cttcgaaagcaccaccctcttcttgaagtgtatccggaagccaatgcacccattggacac
aaccgggaatcttacatggttccatttatacctctctacagaaatggtgacttctttatt
tcatccagagatctaggctatgactacagctacctacaagattcagaaccggactttttt
caagattacattaagccctacttagaacaagcaagtaggatctggccatggctccttggg
gcagccgtggtagggtctgtcctcactgcggtgttgggaggaatcacaaggcggttatgt
tgtcgtcgaaagagaaagcggcttcctgaagaaaagcagccactccttatggaaaaggag
gattacgacagcttgttgtatcagagccatttgtaa

DBGET integrated database retrieval system