KEGG   Sus scrofa (pig): 414431Help
Entry
414431            CDS       T01009                                 

Gene name
PADI6
Definition
(RefSeq) peptidyl arginine deiminase, type VI
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     414431 (PADI6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Vega: 
Position
6
AA seq 691 aa AA seqDB search
MSFQSIIHLSLDSPVHSTCMLGMEICLDLSGCAPQKCESFTIASSPGVLVDIYNVASGKV
TQEAALTQWPLSHPMDVLVKMTSPSSDVNGDKVLVSYFLPHEDVPVATAILYLTGIEVSL
DVDIYRNGDVEMANDKQAKKNWVWGPDGWGAILLVNCALTNRGQIKDGKITKVFSAEDIR
NLSPMVLRVQGPSCILKKHRLLLHTSKEESDKARVYRPQKDSSSTFELVLGPGQHAYALG
PLESDLKETFYVEALQFPSGSFPGLISYSVSLVEESKDGIGPQVIPEILVYKDTVVFRVA
PCIFTPSTQMPLEMYVCRELQVQGFVNAVTELSERSNSQVASVYEDPNRLGRWLQDEMAF
CYTQAPHKTTALVLDTPRVTKLEDFPMRYSLSPGIGYVTLNTLDHTVASIDSIGNLMVSP
PVKVKGKEYPLGRILIGSSFYPSKDGRDMSKALRDFLYAQQVQAPVELFSDWLMIGHIYE
FMCFIPTQFKVEGKKDFRLLLASPSTCYKLFTEKQKQGYGDAALFGEIRKEQLLSNGREA
LTINQLLADENMKKQNDYVERCIDLNRAILKRELGLAEKDIIDIPQLFCLEQIVNVPSNE
LTGKLYARPYFPNLLQIIVMGQNLGIPKPFGPQINGACCLEEKIYELLEPLGFQCTFIND
FDCYLTEIGDFCSCANIRRVPFAFKWWKMVP
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcagagcatcatccatctgtccctggacagccctgtccattccacttgcatg
ttgggaatggaaatctgcttagatctcagtgggtgtgccccacagaagtgcgagtccttc
accatcgctagctctccgggggtcctggttgatatctacaacgttgcgtctgggaaggtc
acgcaggaggctgccctgacccagtggcccctgtcacatcccatggatgtgctggtgaag
atgacatccccgagctccgatgtcaacggggacaaggttttggtctcctacttcctgccc
catgaggatgtccctgtagccacagctatactctatctcactggcatagaagtctctctg
gacgtggatatctaccgcaatggggacgtcgagatggcaaatgacaaacaggctaagaaa
aactgggtctggggccccgatggctggggcgccatcctgcttgtgaactgcgccctgacc
aaccggggccagattaaggacgggaagatcacaaaggtgttctctgcggaggatataagg
aatctgtccccgatggtgctgagagttcaggggcccagctgcattttaaagaaacaccgg
ctgctgctccacacctccaaggaagagtcggacaaggcgagagtctaccggccacaaaag
gacagttccagcacattcgagttggtgctgggcccagggcagcacgcctatgccttgggt
cccctcgaaagcgacttgaaggagaccttctacgtggaagccctgcagttcccgtccggc
agcttcccaggcctgatttcctactcggtctccctggtggaagagtctaaagacgggata
ggacctcaggtgattccagagatcctggtgtacaaggacacggtggtgttccgggtggcc
ccctgcatctttacccccagcacgcagatgcccctggagatgtacgtctgcagagagctg
caggtccagggctttgtgaatgcggtgacggagctgagcgagaggagtaacagccaggtg
gcatccgtctatgaagaccccaaccgcttgggcaggtggctccaggatgagatggccttc
tgctacacccaggctccccacaagaccactgccttggtcctggacacccctcgggtcacc
aagctcgaggacttccccatgagatactcactgagccctgggatcggctacgtgaccctg
aacaccctggaccacaccgtggccagtatagactccatcgggaacctgatggtgtccccg
cctgtcaaggtcaaggggaaagagtaccctctaggcaggatcctcattggcagcagcttt
taccccagcaaggatggccgggacatgagtaaggccctccgggacttcctctacgcccag
caagtccaggccccagtggaactcttctccgactggctgatgatcggccacatctatgag
ttcatgtgcttcatccccacacagttcaaagtggagggcaaaaaggacttccggctgctc
ctggccagccccagcacctgctataagctgttcacggagaaacagaagcagggctatgga
gatgcagctctgtttggagagattaggaaagaacagctgctttctaatgggagggaggcc
cttaccatcaatcaacttctggccgatgaaaacatgaagaaacagaacgactatgtggag
aggtgcatcgacctgaaccgggccatcctgaagcgagagctgggcctggcggagaaggac
atcattgacattccgcagctcttctgcctggagcagattgtcaacgtcccctccaacgag
ctgaccgggaagctctacgcaaggccctacttccctaacctgctgcagataatcgtgatg
ggccagaacctgggcatccccaagcccttcgggccccagatcaacggcgcctgctgcctg
gaggaaaagatctacgagttgctggagcccctgggcttccaatgcaccttcattaacgac
tttgactgctacctgacggaaatcggagacttctgctcctgtgccaacatccgccgggtg
ccctttgccttcaaatggtggaagatggtgccctag

DBGET integrated database retrieval system