KEGG   Sus scrofa (pig): 414916Help
Entry
414916            CDS       T01009                                 

Gene name
PRLR
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
ssc  Sus scrofa (pig)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    414916 (PRLR)
   04151 PI3K-Akt signaling pathway
    414916 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    414916 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    414916 (PRLR)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    414916 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 625 aa AA seqDB search
MKENVPSTVVFILLLFLNISLLNGQSPPGKPEIFKCRSPEKETFTCWWKPGADGGLPTNY
TLTYHKEGETFTHECPDYKTGGPNSCYFNKKHTSIWTIYIITVNATNQMGSSSSDPRYVD
VTYIVEPDPPVNLTLELKKPEDQKPYLWIKWLPPTLVDVRSGWLTLQYEIRLQPEKTAEW
ETHFAGQQTQFKILSLYPGQKYLVQVRCKPDHGFWSEWSPESSIQIPNDFSMKDTTMWIF
VAILSAVVCLIMIWAVALKGYSMVACILPPVPGPKIKGFDTHLLEKGKSEELLSALGCQD
FPPTSDCEDLLVEFLEVDDSEDQQLMPAHSKEHPSQGRKPTHLDPDSDSGRGSCDSPSLL
SEKCDEPRANPPKFHTPEGIEKPGDPETNLPRPQDPQSTSVESKLLYFHADGSKSSTWPL
PQPPILHDPGSSYHNLADVGQLVLGTAGATAALLEKTDRHAFNPPKTTETGGEGRATEQK
ESESFHSKTDQGTVWLLPQDKGPFVSPKPMEYVEIHKVSKDGALALLPKQQENGDRPEKA
GAPETSKEYAQVSRVMDNHILVLVQDPRARNVAPFEEPTKETPPSRPQNPAAKDLAGFTT
APGHCRHPLGGLDYLDPAGFMHSFQ
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatgtgccatccacagtggttttcattttgctactttttctcaacatcagc
cttctgaatggacagtcacctccgggaaaacctgagatcttcaaatgtcgttctcccgaa
aaggaaacattcacctgctggtggaagccgggggcggatggaggacttcctaccaactac
acgctgacttaccacaaggaaggagaaacattcacccatgaatgtccagactacaaaact
ggcggccctaactcctgctacttcaacaagaagcacacctccatatggacaatatacatc
atcacagtgaacgccacgaaccagatgggaagcagttcctcggatccacgttacgtggat
gtgacttacatagttgaaccagaccctcctgtgaacctgactttggaattaaaaaagccc
gaagaccaaaagccatatctgtggatcaaatggcttccacccaccctggttgacgtaaga
tctggttggctcacactccagtatgaaattcgattacaacctgagaaaacagctgagtgg
gagactcatttcgctgggcagcagactcagtttaagattctcagcttgtatccaggacag
aaataccttgtccaggttcgctgcaagccggaccatggattctggagtgagtggagccca
gagagctccatccagatacctaatgacttctcaatgaaagatacaaccatgtggatcttc
gtggctattctttctgctgtcgtctgtttgattatgatctgggcagtggctttgaagggc
tatagcatggtggcctgcatccttccgccagttccagggccaaaaataaaaggatttgac
acccatctgttggagaaaggcaagtccgaagagcttctgagcgccctgggatgccaagac
ttcccccccacttccgactgcgaggacctgctggtggagttcctggaggtggatgacagc
gaggaccagcagctgatgccagcccactccaaggaacacccgagccaaggccggaagccc
acacacctggatcccgacagcgattccggccggggcagctgtgacagcccttcccttttg
tccgaaaagtgcgatgaaccgcgggccaatccccccaagtttcacactcccgagggcatc
gagaagccaggggatcctgaaacaaaccttccccgtccccaggaccctcagagcacaagc
gtggaaagcaagctgctctattttcacgcggatggatccaagtcttcgacttggcctttg
ccgcagcccccgatcctgcacgatccgggatcttcttaccacaaccttgccgacgtgggt
cagctggtcctgggcaccgcaggggccaccgccgctttgctggaaaaaacggaccgacat
gctttcaaccctccaaaaaccaccgagactggcggggaaggaagggcaaccgagcagaag
gagtcggagagcttccactccaagactgaccaaggcacagtgtggctgctgccccaggac
aaggggccctttgtctcccctaagcccatggagtacgtggagatacacaaggtcagcaaa
gatggagcactggcgttgctcccaaaacagcaggagaacggcgaccggccggagaaggct
ggcgcccctgaaaccagcaaggaatacgcccaggtgtcccgggtgatggataaccacatc
ctggtgttagtgcaggatccgcgagctcgaaacgtggctccgtttgaagaaccaaccaag
gagaccccgccatcccggccgcagaatccagctgcgaaagacctggccggcttcaccacg
gccccgggccactgcagacacccgctgggtgggctggattacctcgatcccgcaggcttt
atgcactcctttcagtga

DBGET integrated database retrieval system