KEGG   Sus scrofa (pig): 414916Help
Entry
414916            CDS       T01009                                 

Gene name
PRLR
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
ssc  Sus scrofa (pig)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:ssc04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ssc04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:ssc04080]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:ssc04060]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:ssc04917]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 625 aa AA seqDB search
MKENVPSTVVFILLLFLNISLLNGQSPPGKPEIFKCRSPEKETFTCWWKPGADGGLPTNY
TLTYHKEGETFTHECPDYKTGGPNSCYFNKKHTSIWTIYIITVNATNQMGSSSSDPRYVD
VTYIVEPDPPVNLTLELKKPEDQKPYLWIKWLPPTLVDVRSGWLTLQYEIRLQPEKTAEW
ETHFAGQQTQFKILSLYPGQKYLVQVRCKPDHGFWSEWSPESSIQIPNDFSMKDTTMWIF
VAILSAVVCLIMIWAVALKGYSMVACILPPVPGPKIKGFDTHLLEKGKSEELLSALGCQD
FPPTSDCEDLLVEFLEVDDSEDQQLMPAHSKEHPSQGRKPTHLDPDSDSGRGSCDSPSLL
SEKCDEPRANPPKFHTPEGIEKPGDPETNLPRPQDPQSTSVESKLLYFHADGSKSSTWPL
PQPPILHDPGSSYHNLADVGQLVLGTAGATAALLEKTDRHAFNPPKTTETGGEGRATEQK
ESESFHSKTDQGTVWLLPQDKGPFVSPKPMEYVEIHKVSKDGALALLPKQQENGDRPEKA
GAPETSKEYAQVSRVMDNHILVLVQDPRARNVAPFEEPTKETPPSRPQNPAAKDLAGFTT
APGHCRHPLGGLDYLDPAGFMHSFQ
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatgtgccatccacagtggttttcattttgctactttttctcaacatcagc
cttctgaatggacagtcacctccgggaaaacctgagatcttcaaatgtcgttctcccgaa
aaggaaacattcacctgctggtggaagccgggggcggatggaggacttcctaccaactac
acgctgacttaccacaaggaaggagaaacattcacccatgaatgtccagactacaaaact
ggcggccctaactcctgctacttcaacaagaagcacacctccatatggacaatatacatc
atcacagtgaacgccacgaaccagatgggaagcagttcctcggatccacgttacgtggat
gtgacttacatagttgaaccagaccctcctgtgaacctgactttggaattaaaaaagccc
gaagaccaaaagccatatctgtggatcaaatggcttccacccaccctggttgacgtaaga
tctggttggctcacactccagtatgaaattcgattacaacctgagaaaacagctgagtgg
gagactcatttcgctgggcagcagactcagtttaagattctcagcttgtatccaggacag
aaataccttgtccaggttcgctgcaagccggaccatggattctggagtgagtggagccca
gagagctccatccagatacctaatgacttctcaatgaaagatacaaccatgtggatcttc
gtggctattctttctgctgtcgtctgtttgattatgatctgggcagtggctttgaagggc
tatagcatggtggcctgcatccttccgccagttccagggccaaaaataaaaggatttgac
acccatctgttggagaaaggcaagtccgaagagcttctgagcgccctgggatgccaagac
ttcccccccacttccgactgcgaggacctgctggtggagttcctggaggtggatgacagc
gaggaccagcagctgatgccagcccactccaaggaacacccgagccaaggccggaagccc
acacacctggatcccgacagcgattccggccggggcagctgtgacagcccttcccttttg
tccgaaaagtgcgatgaaccgcgggccaatccccccaagtttcacactcccgagggcatc
gagaagccaggggatcctgaaacaaaccttccccgtccccaggaccctcagagcacaagc
gtggaaagcaagctgctctattttcacgcggatggatccaagtcttcgacttggcctttg
ccgcagcccccgatcctgcacgatccgggatcttcttaccacaaccttgccgacgtgggt
cagctggtcctgggcaccgcaggggccaccgccgctttgctggaaaaaacggaccgacat
gctttcaaccctccaaaaaccaccgagactggcggggaaggaagggcaaccgagcagaag
gagtcggagagcttccactccaagactgaccaaggcacagtgtggctgctgccccaggac
aaggggccctttgtctcccctaagcccatggagtacgtggagatacacaaggtcagcaaa
gatggagcactggcgttgctcccaaaacagcaggagaacggcgaccggccggagaaggct
ggcgcccctgaaaccagcaaggaatacgcccaggtgtcccgggtgatggataaccacatc
ctggtgttagtgcaggatccgcgagctcgaaacgtggctccgtttgaagaaccaaccaag
gagaccccgccatcccggccgcagaatccagctgcgaaagacctggccggcttcaccacg
gccccgggccactgcagacacccgctgggtgggctggattacctcgatcccgcaggcttt
atgcactcctttcagtga

DBGET integrated database retrieval system