KEGG   Sus scrofa (pig): 445459Help
Entry
445459            CDS       T01009                                 

Gene name
IFNB1, IFN-beta, IFNb
Definition
interferon, beta 1, fibroblast
Orthology
K05415  
interferon beta
Organism
ssc  Sus scrofa (pig)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Chagas disease (American trypanosomiasis)
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    445459 (IFNB1)
   04151 PI3K-Akt signaling pathway
    445459 (IFNB1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    445459 (IFNB1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    445459 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    445459 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    445459 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    445459 (IFNB1)
  Development
   04380 Osteoclast differentiation
    445459 (IFNB1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    445459 (IFNB1)
   05162 Measles
    445459 (IFNB1)
   05164 Influenza A
    445459 (IFNB1)
   05161 Hepatitis B
    445459 (IFNB1)
   05160 Hepatitis C
    445459 (IFNB1)
   05168 Herpes simplex infection
    445459 (IFNB1)
   05142 Chagas disease (American trypanosomiasis)
    445459 (IFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23-q27; 1
AA seq 186 aa AA seqDB search
MANKCILQIALLMCFSTTALSMSYDVLRYQQRSSNLACQKLLEQLPGTPQYCLEDRMNFE
VPEEIMQPPQFQKEDAVLIIHEMLQQIFGILRRNFSSTGWNETVIKTILVELDGQMDDLE
TILEEIMEEENFPRGDMTILHLKKYYLSILQYLKSKEYRSCAWTVVQVEILRNFSFLNRL
TDYLRN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaagtgcatcctccaaatcgctctcctgatgtgtttctccaccacagctctt
tccatgagctatgatgtgcttcgataccaacaaaggagcagcaatttggcatgtcagaag
ctcctggaacagttgcctgggactcctcaatattgcctcgaagataggatgaacttcgag
gtccctgaggagattatgcaaccaccacaattccagaaggaagatgcagtattgattatc
cacgagatgctccagcagatcttcggcattctcagaagaaatttctctagcactggctgg
aatgaaaccgtcattaagactatccttgtggaacttgatgggcagatggatgacctggag
acaatcctggaggaaatcatggaggaggaaaatttccccaggggagacatgaccattctt
cacctgaagaaatattacttgagcattctgcagtacctgaagtccaaggagtacagaagc
tgtgcctggacagtcgtccaagtggaaatcctcaggaacttttctttccttaacagactt
acagattacctccggaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system