KEGG   Sus scrofa (pig): 445459Help
Entry
445459            CDS       T01009                                 

Gene name
IFNB1, IFN-beta, IFNb
Definition
interferon, beta 1, fibroblast
Orthology
K05415  
interferon beta
Organism
ssc  Sus scrofa (pig)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Chagas disease (American trypanosomiasis)
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:ssc04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ssc04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:ssc04060]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:ssc04620]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:ssc04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:ssc04623]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:ssc04650]
Organismal Systems; Development; Osteoclast differentiation [PATH:ssc04380]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ssc05152]
Human Diseases; Infectious diseases; Measles [PATH:ssc05162]
Human Diseases; Infectious diseases; Influenza A [PATH:ssc05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:ssc05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:ssc05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:ssc05168]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:ssc05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23-q27; 1
AA seq 186 aa AA seqDB search
MANKCILQIALLMCFSTTALSMSYDVLRYQQRSSNLACQKLLEQLPGTPQYCLEDRMNFE
VPEEIMQPPQFQKEDAVLIIHEMLQQIFGILRRNFSSTGWNETVIKTILVELDGQMDDLE
TILEEIMEEENFPRGDMTILHLKKYYLSILQYLKSKEYRSCAWTVVQVEILRNFSFLNRL
TDYLRN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaagtgcatcctccaaatcgctctcctgatgtgtttctccaccacagctctt
tccatgagctatgatgtgcttcgataccaacaaaggagcagcaatttggcatgtcagaag
ctcctggaacagttgcctgggactcctcaatattgcctcgaagataggatgaacttcgag
gtccctgaggagattatgcaaccaccacaattccagaaggaagatgcagtattgattatc
cacgagatgctccagcagatcttcggcattctcagaagaaatttctctagcactggctgg
aatgaaaccgtcattaagactatccttgtggaacttgatgggcagatggatgacctggag
acaatcctggaggaaatcatggaggaggaaaatttccccaggggagacatgaccattctt
cacctgaagaaatattacttgagcattctgcagtacctgaagtccaaggagtacagaagc
tgtgcctggacagtcgtccaagtggaaatcctcaggaacttttctttccttaacagactt
acagattacctccggaactga

DBGET integrated database retrieval system