KEGG   Sus scrofa (pig): 445533Help
Entry
445533            CDS       T01009                                 

Gene name
PC2, PCSK2
Definition
pro-hormone convertase (EC:3.4.21.94)
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     445533 (PC2)
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S8: subtilisin family
   445533 (PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 638 aa AA seqDB search
MKGGCVSQWKAAAGLLFCVTVFASAERPVFTNHFLVELHKGGEEEARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQRLERDPRVKRALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYSSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGAVKEWTLMLHGSQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILGKH
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtggctgtgtctcccagtggaaggcggccgccgggctcctcttctgtgtcacg
gtttttgcgtctgccgaaagaccggtcttcacaaatcattttcttgtggagttgcataaa
gggggagaggaagaagctcgccaagttgcagcagaacacggctttggagtccgaaagctt
ccttttgctgaaggcctgtaccatttttatcacaatggcctggcaaaggccaagagaaga
cgcagcctacaccataagcagcggctggagagagaccccagggtaaagagagctttgcaa
caggaagggttcgatcggaaaaagcgagggtatagagacatcaatgaaatcgacatcaac
atgaatgaccctctttttacgaagcagtggtatctgatcaatactggacaagctgatggt
acccctggccttgacttgaatgtggcagaagcctgggagctgggatacactgggaaaggt
gttaccattggaattatggacgatggaatcgactatctccacccggacctggcctcgaac
tacaatgcggaagcgagctacgactttagcagcaacgacccctacccttaccctcgctac
acagacgactggtttaacagccacgggacccgatgtgccggggaggtttctgccgcagcc
aacaacaatatctgcggggttggagtggcctacagctccaaggttgcaggtatccggatg
ctggaccagcccttcatgacggacatcatcgaggcctcttccatcagccacatgcctcag
ctaattgacatctacagcgccagctggggccccaccgacaacgggaagacggtggacggg
ccgcgggagctcacgcttcaggcgatggccgacggtgtgaacaagggccgagggggcaaa
ggcagcatctacgtgtgggcctccggggacggtggcagctacgacgactgcaactgtgac
ggctatgcctccagcatgtggaccatctccatcaactctgccatcaacgacggcaggacc
gccctgtacgacgagagctgctcctccaccttggcctccaccttcagcaatgggaggaag
aggaaccccgaggccggcgtggcaaccacagatttgtacggcaactgcactctgaggcat
tctgggacatccgcggctgctcctgaggcagctggagtgtttgcactggctttagaggct
aacctgggtctgacctggagagacatgcagcatctgaccgtgctcacttccaaacggaac
caacttcatgatgaggtccatcagtggcggagaaacggagtcggcctagagtttaatcac
ctctttggctatggagtccttgacgcaggggccatggtgaaaatggctaaagactggaaa
accgtgcctgagagattccactgtgtgggaggctccgtacaggaccctgaaaaaatacca
tccactggcaagctggtgctgacgctcaccaccgatgcatgtgaggggaaggaaaatttc
gtccgctacctggagcacgtccaagctgtcatcacggtcaatgcgacccggagaggagac
ctgaacattaacatgacatcccccatgggcaccaagtccatcctgctgagccggcgcccg
agggacgacgactccaaggtgggcttcgacaagtggcctttcatgaccacccacacgtgg
ggggaggatgcccgaggcacctggaccctggagctaggctttgtggggagcgcaccccag
aagggggctgtgaaggagtggacgctgatgctgcacggcagccagagcgccccttacatc
gaccaggtggtgagggattaccagtccaagctggccatgtccaagaaggaggagctggag
gaagagctggacgaagcagtggagagaagcctgaagagcatcctgggcaagcactag

DBGET integrated database retrieval system