KEGG   Sus scrofa (pig): 448846Help
Entry
448846            CDS       T01009                                 

Gene name
EHHADH
Definition
(RefSeq) enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
13
AA seq 515 aa AA seqDB search
MDTIFSEALLKMRKQYPGCLAQETCVRAVQAAVQYPYETGIKKEEELFMYLQKSGQARAL
QYAFLAERSANKWSTPSGASWKTASAQPISSVGILGLGTMGRGIAVSFAKAKIPVIAVEP
DKKQLENANKIITSLLEKEASKMQQSGHPWSGPKPRLTTSMKELSGVDLVIEAVFEEMNL
KKQVFAELSAVCKPQAFLCTNTSALDIDEIASSTNRPHLVIGTHFFSPAHVMKLLEVIPS
RYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLKPYYDQTYFLLEDGSMPEEIDQV
LEEFGFRMGPFRVSDLAGLDIGWKSRKGQGLTGPALPPGTSARKRGNQRYCPVPDMLCEL
GRFGQKTGKGWYLYDKPLGRIHKPDPWFSKFLTQYRETHHIEPRVISRDEILDRCLYSLI
NEAFRILEDGIAATPEHIDVVYLHGYGWPRHRGGPMFYASTVGLPTVLEKLQKYHRQNPD
IPQLEPCDYLKKLASQGNPPLKEWQSLAGPPSSKL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggacaccattttcagtgaagcccttttgaagatgcgaaagcagtaccctgggtgcctt
gctcaggagacttgcgtccgtgcagtccaggccgctgtccaatatccctatgagacgggc
atcaagaaggaagaggagctgtttatgtaccttcagaaatcagggcaggctagagccctg
caatatgctttcttggcggagaggagtgcaaataagtggtccactccctctggagcatcc
tggaaaacagcatcggcacagcccatctcctctgttggcattctcggcttgggaacgatg
ggccgaggcattgctgtttcttttgcaaaggccaaaatccccgtgattgctgtagaacca
gacaagaagcaactagagaatgccaacaagataataacctccctcttggaaaaggaagca
tccaaaatgcagcagagtggccatccttggtcaggaccaaaacccaggttaactacatct
atgaaagagcttagtggtgtagatttagtcattgaagcagtatttgaggaaatgaacctg
aagaaacaggtctttgctgaactgtcagccgtgtgcaagccacaagcatttttgtgcacc
aatacttccgccctggacattgatgaaattgcttcttccaccaatcgtcctcacttagtc
attggcacccacttcttctcaccagctcatgtgatgaagttgttagaggttattcccagc
cgatactcttcccccactaccattgccactgttatgaatttatcaaaaaagattaagaaa
attggagtagttgtaggcaactgttttggatttgttggaaatcgaatgttgaagccttat
tatgatcagacatatttcttattagaagatggcagtatgccagaggagatagatcaggtg
ctggaagagtttggtttcagaatgggaccttttagagtatctgatcttgctgggttggat
ataggttggaaatctcggaaagggcaaggtcttactggacctgcattgcctccaggaact
tctgcccgaaagcgaggcaaccagaggtactgcccagttcctgatatgctctgtgaattg
ggacggtttggccagaagacaggtaagggttggtacctttatgataagccattgggtagg
attcacaaacctgatccctggttttccaaatttctgacacagtacagagaaacccatcac
attgaaccacgtgtcattagccgggatgagatccttgaccgctgcttatattcactcatc
aatgaagcattccgcatcctggaagatgggatagcagctaccccagagcacattgatgtg
gtctatttacacgggtatggatggccaaggcacaggggtgggcctatgttctatgcttcc
acagttgggttgcccacagtgctagagaagttgcagaaatatcacaggcagaatcctgat
attccccaactagagccttgtgactatctgaaaaaactggcttcccagggaaaccctccc
ctgaaagaatggcaaagcttggcaggaccccccagcagtaagttgtga

DBGET integrated database retrieval system