KEGG   Sus scrofa (pig): 448846Help
Entry
448846            CDS       T01009                                 

Gene name
EHHADH
Definition
(RefSeq) enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
  KO
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
ssc  Sus scrofa (pig)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    448846 (EHHADH)
   01212 Fatty acid metabolism
    448846 (EHHADH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    448846 (EHHADH)
   00650 Butanoate metabolism
    448846 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    448846 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    448846 (EHHADH)
   00310 Lysine degradation
    448846 (EHHADH)
   00380 Tryptophan metabolism
    448846 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    448846 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    448846 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    448846 (EHHADH)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     448846 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     448846 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     448846 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
13
AA seq 515 aa AA seqDB search
MDTIFSEALLKMRKQYPGCLAQETCVRAVQAAVQYPYETGIKKEEELFMYLQKSGQARAL
QYAFLAERSANKWSTPSGASWKTASAQPISSVGILGLGTMGRGIAVSFAKAKIPVIAVEP
DKKQLENANKIITSLLEKEASKMQQSGHPWSGPKPRLTTSMKELSGVDLVIEAVFEEMNL
KKQVFAELSAVCKPQAFLCTNTSALDIDEIASSTNRPHLVIGTHFFSPAHVMKLLEVIPS
RYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLKPYYDQTYFLLEDGSMPEEIDQV
LEEFGFRMGPFRVSDLAGLDIGWKSRKGQGLTGPALPPGTSARKRGNQRYCPVPDMLCEL
GRFGQKTGKGWYLYDKPLGRIHKPDPWFSKFLTQYRETHHIEPRVISRDEILDRCLYSLI
NEAFRILEDGIAATPEHIDVVYLHGYGWPRHRGGPMFYASTVGLPTVLEKLQKYHRQNPD
IPQLEPCDYLKKLASQGNPPLKEWQSLAGPPSSKL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggacaccattttcagtgaagcccttttgaagatgcgaaagcagtaccctgggtgcctt
gctcaggagacttgcgtccgtgcagtccaggccgctgtccaatatccctatgagacgggc
atcaagaaggaagaggagctgtttatgtaccttcagaaatcagggcaggctagagccctg
caatatgctttcttggcggagaggagtgcaaataagtggtccactccctctggagcatcc
tggaaaacagcatcggcacagcccatctcctctgttggcattctcggcttgggaacgatg
ggccgaggcattgctgtttcttttgcaaaggccaaaatccccgtgattgctgtagaacca
gacaagaagcaactagagaatgccaacaagataataacctccctcttggaaaaggaagca
tccaaaatgcagcagagtggccatccttggtcaggaccaaaacccaggttaactacatct
atgaaagagcttagtggtgtagatttagtcattgaagcagtatttgaggaaatgaacctg
aagaaacaggtctttgctgaactgtcagccgtgtgcaagccacaagcatttttgtgcacc
aatacttccgccctggacattgatgaaattgcttcttccaccaatcgtcctcacttagtc
attggcacccacttcttctcaccagctcatgtgatgaagttgttagaggttattcccagc
cgatactcttcccccactaccattgccactgttatgaatttatcaaaaaagattaagaaa
attggagtagttgtaggcaactgttttggatttgttggaaatcgaatgttgaagccttat
tatgatcagacatatttcttattagaagatggcagtatgccagaggagatagatcaggtg
ctggaagagtttggtttcagaatgggaccttttagagtatctgatcttgctgggttggat
ataggttggaaatctcggaaagggcaaggtcttactggacctgcattgcctccaggaact
tctgcccgaaagcgaggcaaccagaggtactgcccagttcctgatatgctctgtgaattg
ggacggtttggccagaagacaggtaagggttggtacctttatgataagccattgggtagg
attcacaaacctgatccctggttttccaaatttctgacacagtacagagaaacccatcac
attgaaccacgtgtcattagccgggatgagatccttgaccgctgcttatattcactcatc
aatgaagcattccgcatcctggaagatgggatagcagctaccccagagcacattgatgtg
gtctatttacacgggtatggatggccaaggcacaggggtgggcctatgttctatgcttcc
acagttgggttgcccacagtgctagagaagttgcagaaatatcacaggcagaatcctgat
attccccaactagagccttgtgactatctgaaaaaactggcttcccagggaaaccctccc
ctgaaagaatggcaaagcttggcaggaccccccagcagtaagttgtga

DBGET integrated database retrieval system