KEGG   Sus scrofa (pig): 574062Help
Entry
574062            CDS       T01009                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04015  Rap1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04114  Oocyte meiosis
ssc04218  Cellular senescence
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04370  VEGF signaling pathway
ssc04380  Osteoclast differentiation
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04611  Platelet activation
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04668  TNF signaling pathway
ssc04670  Leukocyte transendothelial migration
ssc04714  Thermogenesis
ssc04722  Neurotrophin signaling pathway
ssc04723  Retrograde endocannabinoid signaling
ssc04728  Dopaminergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04912  GnRH signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04917  Prolactin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05014  Amyotrophic lateral sclerosis (ALS)
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05140  Leishmaniasis
ssc05142  Chagas disease (American trypanosomiasis)
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05164  Influenza A
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05205  Proteoglycans in cancer
ssc05418  Fluid shear stress and atherosclerosis
Module
ssc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    574062 (MAPK12)
   04010 MAPK signaling pathway
    574062 (MAPK12)
   04370 VEGF signaling pathway
    574062 (MAPK12)
   04668 TNF signaling pathway
    574062 (MAPK12)
   04068 FoxO signaling pathway
    574062 (MAPK12)
   04071 Sphingolipid signaling pathway
    574062 (MAPK12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    574062 (MAPK12)
   04218 Cellular senescence
    574062 (MAPK12)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    574062 (MAPK12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    574062 (MAPK12)
   04620 Toll-like receptor signaling pathway
    574062 (MAPK12)
   04621 NOD-like receptor signaling pathway
    574062 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    574062 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    574062 (MAPK12)
   04660 T cell receptor signaling pathway
    574062 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    574062 (MAPK12)
   04659 Th17 cell differentiation
    574062 (MAPK12)
   04657 IL-17 signaling pathway
    574062 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    574062 (MAPK12)
   04670 Leukocyte transendothelial migration
    574062 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    574062 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    574062 (MAPK12)
   04917 Prolactin signaling pathway
    574062 (MAPK12)
   04926 Relaxin signaling pathway
    574062 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    574062 (MAPK12)
  Nervous system
   04728 Dopaminergic synapse
    574062 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    574062 (MAPK12)
   04722 Neurotrophin signaling pathway
    574062 (MAPK12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    574062 (MAPK12)
  Development
   04380 Osteoclast differentiation
    574062 (MAPK12)
  Environmental adaptation
   04714 Thermogenesis
    574062 (MAPK12)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    574062 (MAPK12)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    574062 (MAPK12)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    574062 (MAPK12)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    574062 (MAPK12)
  Infectious diseases
   05132 Salmonella infection
    574062 (MAPK12)
   05133 Pertussis
    574062 (MAPK12)
   05152 Tuberculosis
    574062 (MAPK12)
   05164 Influenza A
    574062 (MAPK12)
   05160 Hepatitis C
    574062 (MAPK12)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    574062 (MAPK12)
   05169 Epstein-Barr virus infection
    574062 (MAPK12)
   05145 Toxoplasmosis
    574062 (MAPK12)
   05140 Leishmaniasis
    574062 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    574062 (MAPK12)
  Drug resistance
   01522 Endocrine resistance
    574062 (MAPK12)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     574062 (MAPK12)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   574062 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 574062
NCBI-ProteinID: NP_001020395
UniProt: Q4PS87
Position
5
AA seq 367 aa AA seqDB search
MSSPPPSRKGFYRQEVTKTAWEVRVVYQDLQPVGSGAYGAVCSAVDTRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHDNVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSDDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFRGSDHLDQLKEIMK
VTGTPPEEFVQRLHSADAKNYMKGLPELEKKDFASVLTNASPLAVNLLEKMLVLDAERRV
TAAEALTHPYFESLQDTEDEPKAQKYDESFDDVDRTLDEWKRVTYKEVLSFKPPQQLGTK
VSKETAL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccgccgccctcccgcaagggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgtcgtgtaccaggacctgcagcccgtgggctcgggcgcctacggcgcc
gtgtgctcggcggtggacacccgcaccggggccaaggtggccatcaagaagctgtaccgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgacaacgtgattggactgctggacgtgttcacgcctgatgagaccctggat
gattttacagacttttacctggtgatgccgttcatgggcaccgacctgggaaagctcatg
aagcacgagaagctgagtgacgaccgaatccagttccttgtctaccagatgctgaagggg
ctgaagtacatccatgctgctggcgtcatccacagggacctgaagcctggcaacctggcg
gtgaatgaggactgtgaactgaagatcctggacttcggcctggccagacaggccgacagc
gagatgactgggtacgtggtgacgcgctggtaccgggcacctgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtcagtgggctgcatcatggccgagatgatc
acaggaaagacgctcttcagaggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgccccccgaggagttcgtgcagaggctgcatagtgcggatgccaagaat
tacatgaagggtctccctgagctggagaaaaaggattttgcctccgtcctgaccaacgca
agccctctggcggtgaacctcctggagaaaatgctggtgctggatgcagagcggcgggtg
acggcggccgaggcgttgacccacccctacttcgagtcgctgcaggacacggaggatgag
cccaaggcccagaagtatgacgagtcctttgatgacgtggatcgcacgctggacgagtgg
aagcgtgtcacgtataaagaggtgctcagcttcaagcctccccagcagctggggaccaag
gtctccaaggaaacggccctgtga

DBGET integrated database retrieval system