KEGG   Sus scrofa (pig): 574063Help
Entry
574063            CDS       T01009                                 

Gene name
AURKA, ARK-1, STK6
Definition
(RefSeq) aurora kinase A (EC:2.7.11.1)
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    574063 (AURKA)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     574063 (AURKA)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   574063 (AURKA)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     574063 (AURKA)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    574063 (AURKA)
  Spindle formation proteins
   574063 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    574063 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 405 aa AA seqDB search
MDKCKENCISGLKTTVPPGDGPKRVPVTQHFPAQHLPSANSGQAQRVLCPSNSSQRLPSH
TQKLVSSHKPVQNLKQKQSQATSGPRPVSRPLSNTQQSEQPQPAAPGNNPEKEAASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKTQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELRELQKLSKFDEQRTATYI
TELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLP
PEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFAPEGAR
DLISRLLKHNPSHRPTLKEVLEHPWITANSKPASSHKKESTSKQP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatgtaaagaaaactgcatttcggggcttaagaccacagttccacctggcgat
ggtccaaaacgggttccagtgacccagcactttccagctcagcatctgccgtctgcaaac
agcggccaggcccagcgggtcttatgtccttcgaattcctcacagcgcctgccttcgcac
acgcagaagctcgtctccagccataaaccagttcagaatctgaagcagaagcagtcgcag
gcaaccagtggccctcgtcctgtctccaggcctctgagtaacacccagcagagtgagcag
ccccagccggcagcgcctggaaacaatcctgaaaaggaagcggcatcaaaacagaaaaat
gaagaatcaaaaaaaaggcaatgggctttggaagattttgaaattggccgcccgctgggt
aaaggaaagtttggtaatgtttatttagcaagagaaaaacaaagcaagtttatcctggct
cttaaagtattgtttaaaactcagctggagaaggcaggagttgagcatcagctgagaaga
gaagtagaaatacagtcccaccttaggcatccaaatattctcagactgtatggttatttc
catgacgctaccagagtttacctaatcctggaatacgcacctctcggagctgtctataga
gaacttagagaacttcagaaactgtcaaagtttgatgagcagagaactgctacttatatc
acagaattggcaaatgccctatcttactgtcactcaaagagagttattcacagagacatt
aagccagagaacctgctccttggatccgctggagagcttaagattgccgattttgggtgg
tcggtccatgccccgtcctccaggagaaccaccctctgcggcaccctggactacttgccc
cccgagatgatcgaaggccggatgcatgacgagaaggtggatctctggagcttgggggtg
ctttgctatgaattcctggttgggaagcccccctttgaggcaaacacgtaccaagagacc
tacaaaaggatatcccgggtggaattcaccttccctgactttgcgcccgagggagccagg
gacctcatctcaagactattgaagcacaaccccagccacaggcccaccctcaaggaggtg
ctcgaacacccctggatcaccgccaattccaagccagcaagtagtcacaaaaaagaatcc
accagcaagcaaccctaa

DBGET integrated database retrieval system