KEGG   Sus scrofa (pig): 574063Help
Entry
574063            CDS       T01009                                 

Gene name
AURKA, ARK-1, STK6
Definition
aurora kinase A (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    574063 (AURKA)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     574063 (AURKA)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   574063 (AURKA)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     574063 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 405 aa AA seqDB search
MDKCKENCISGLKTTVPPGDGPKRVPVTQHFPAQHLPSANSGQAQRVLCPSNSSQRLPSH
TQKLVSSHKPVQNLKQKQSQATSGPRPVSRPLSNTQQSEQPQPAAPGNNPEKEAASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKTQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELRELQKLSKFDEQRTATYI
TELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLP
PEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFAPEGAR
DLISRLLKHNPSHRPTLKEVLEHPWITANSKPASSHKKESTSKQP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatgtaaagaaaactgcatttcggggcttaagaccacagttccacctggcgat
ggtccaaaacgggttccagtgacccagcactttccagctcagcatctgccgtctgcaaac
agcggccaggcccagcgggtcttatgtccttcgaattcctcacagcgcctgccttcgcac
acgcagaagctcgtctccagccataaaccagttcagaatctgaagcagaagcagtcgcag
gcaaccagtggccctcgtcctgtctccaggcctctgagtaacacccagcagagtgagcag
ccccagccggcagcgcctggaaacaatcctgaaaaggaagcggcatcaaaacagaaaaat
gaagaatcaaaaaaaaggcaatgggctttggaagattttgaaattggccgcccgctgggt
aaaggaaagtttggtaatgtttatttagcaagagaaaaacaaagcaagtttatcctggct
cttaaagtattgtttaaaactcagctggagaaggcaggagttgagcatcagctgagaaga
gaagtagaaatacagtcccaccttaggcatccaaatattctcagactgtatggttatttc
catgacgctaccagagtttacctaatcctggaatacgcacctctcggagctgtctataga
gaacttagagaacttcagaaactgtcaaagtttgatgagcagagaactgctacttatatc
acagaattggcaaatgccctatcttactgtcactcaaagagagttattcacagagacatt
aagccagagaacctgctccttggatccgctggagagcttaagattgccgattttgggtgg
tcggtccatgccccgtcctccaggagaaccaccctctgcggcaccctggactacttgccc
cccgagatgatcgaaggccggatgcatgacgagaaggtggatctctggagcttgggggtg
ctttgctatgaattcctggttgggaagcccccctttgaggcaaacacgtaccaagagacc
tacaaaaggatatcccgggtggaattcaccttccctgactttgcgcccgagggagccagg
gacctcatctcaagactattgaagcacaaccccagccacaggcccaccctcaaggaggtg
ctcgaacacccctggatcaccgccaattccaagccagcaagtagtcacaaaaaagaatcc
accagcaagcaaccctaa

DBGET integrated database retrieval system