KEGG   Sus scrofa (pig): 574068Help
Entry
574068            CDS       T01009                                 

Gene name
NCOA1, SRC1
Definition
nuclear receptor coactivator 1 (EC:2.3.1.48)
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
Thyroid hormone signaling pathway
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ssc04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1440 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAIMGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEEFMRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPPVNPSISPAHGVARSSSLPPSNSNMVSTRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVAGVALNQGQASSQSTNPPLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLNSPVSMTSTACNNSNRSYSNIPVTS
LQSMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLNIQPAKAESKDNKETASILNEMIQSDN
SSNDGKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
TGTSSSASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVPGNSGIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPMTKPPPEEIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCETERMDGAV
TSVTIKSEILPATLQSTTARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWANNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSGPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRRRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVPMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAENPEATLGN
RNSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEANFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPASGYQSPDMKAWQQGAMGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLTE
NT seq 4323 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatctgaccctgctaacccagactcacataagagaaaa
ggatcaccatgtgacacattggcatcaagcactgaaaaaaggcgcagggaacaagaaaat
aaatatttagaagagctagctgagttactgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagatattaaagaagacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgatgaagtacagaaatcagatatctcg
tcgagtagtcaaggggtgatagaaaaagaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggaggattgtatttgtgtcagagaatgtg
accagctacttgggttacaatcaggaggagttaatgaacaccagtgtctatagcatactg
cacgtgggggatcatgcagaatttgtgaagaatctgctgccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggcaccgagaaccaagaagcttgccagcggtatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtttgatttgtattgcccggcgattacctcggcctccagctattatgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgataccagttccctg
agagctgcgggcagaactggctgggaagaatttatgagaaagtgcatatatgctttcttc
caacctcaaggcagagagccatcgtatgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctataggttcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcagcctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaattctgga
atgtcaattccccgggtaaatcctcccgtcaatcctagtatctctccagctcacggtgtg
gcccgttcatcttcattgccaccatccaacagcaacatggtatccaccagagtaaaccgc
caacagagctcagaccttcacagcagcagtcacagtaattctagcaacagccaagggagt
tttggatgctcacctggaaatcagattgtagccggtgttgccttaaaccagggacaggct
agttcccagagcactaatccccctttaaacctcaataattctcctatggaaggtacagga
atatcccttgcacagttcatgtctccaaggaggcaagttagttctggattggcaacaaga
cccagaatgccgaacaattcatttcctcctaatattccgacattaaactcccctgttagc
atgacaagtactgcctgtaataatagtaaccgatcttattcaaacatcccagtaacatct
ttgcagagtatgaatgaaggacccaataactctgttggcttttctgctggttctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacagccagcaaaagct
gagtccaaagataacaaagagactgcatccattttaaatgaaatgattcagtctgacaac
agctctaatgatggcaaacctctggattctgggcttctgcataacaatgacagactctca
gatggggacaataaatactctcaaaccagtcacaaactggtgcagcttttgacaacaact
gcagagcagcagttacggcatgctgatatagacacaagctgcaaagaggtattgtcttgc
acaggcacttccagctctgcctctgctaactcttcaagtggctcttgcccctcctctcat
agctcactgacggagcggcacaaaattctccaccgactcttacaggagggtagcccctcg
gatatcacaactttgtctgtggagcctgataaaaaggacagtgcctctacttctgtgtca
gtgactgggcaggtaccagggaactccggtataaaactggaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagcttctacgctaccttttagataaagatgagaaagattta
agatcaactcctaacctgagcctggatgacgtaaaggtaaaagtggaaaagaaggaacag
atggatccttgtaacacaaacccaaccccaatgacaaaacctcctcctgaggaaattaaa
ctggagtcacagagccagtttacagctgaccttgaccagtttgatcagttactacccaca
ctggagaaggcagcacagttaccaggcttatgtgagacagagaggatggatggtgcggtc
accagcgtaaccatcaaatcggagatcctgccagctacacttcagtccaccactgccaga
cctacttccaggctgaatagattacctgagctagaattggaagcaattgataaccagttt
ggacaaccgggaacaggtgatcagattccatgggcaaataatacagtgacagctgtaaat
cagaataaaccagaagaccagtgtattagttcacaattagatgagcttctctgtccacca
acaacagttgaaggaagaaatgatgagaaggctcttcttgaacagctggtatccttcctc
agcggcaaagatgaaactgagttagcggaactagacagagctctgggaatcgacaaactt
gttcagggaggaggattggatgtattatcagagagatttccaccacaacaagcaacaccg
ccattgatgatggaagaaagacccaacctttattcacagccttattcttctccatcacct
actgccaatctctctggccccttccaaggcatggtcaggcaaaaaccttcattggggact
atgcctgttcaagtaacacctccccgaggtgctttttcacctggcatgggcatgcagccc
aggcagactctaaacagacctccagctgcacccaaccaactaagacttcagcttcagcaa
cgattacagggacaacagcagttgatacaccaaaatcggcaggctatcttgaaccagttt
gcagcaaacgctcctgttggcatcaatatgagatcaggcatgcaacagcaaattacacct
cagccacccctgaatgcccaaatgttggcccagcgccagcgggagttatacagtcaacag
caccgacggaggcagctaatacagcagcagagagccatgctcatgaggcagcaaagcttt
gggaacaacctccctccctcgtctggactgccagttccaatggggaacccccgtcttcct
cagggtgctccgcagcaattcccctacccaccaaactatggtacaaatcccggaactcca
cccgcttctaccagccccttttcacaactggcagaaaaccctgaggcaaccttgggcaac
cgcaacagcatggtgaacagaggcatgacaggaaacatgggaggacagtttggcactgga
atcaatcctcagatgcagcagaatgtcttccagtatccaggatcaggaatggttccccaa
ggtgaggccaactttgctccatctcttagccctgggagctccatggtgccgatgccaatc
cctccgcctcagagctctctgctccagcagactccgcctgcttctggctaccagtcacca
gacatgaaggcctggcagcaaggagcaatgggaaacaacaatgtgttcagtcaagctgtc
cagaaccagcccacgcctgcacagccaggagtgtacaacaatatgagcatcaccgtgtcc
atggcaggtggaaatacaaatgttcagaacatgaacccaatgatgggccagatgcagatg
agctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatccagcc
ctgagacacacaggcctctactgcaaccagctctcatctactgaccttctcaaaacagaa
gcagatggaacccaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtgaat
ctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaacccacg
gcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgactgaa
taa

DBGET integrated database retrieval system