KEGG   Sus scrofa (pig): 641353Help
Entry
641353            CDS       T01009                                 

Gene name
ADRA2B
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
ssc  Sus scrofa (pig)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:ssc04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 446 aa AA seqDB search
MDHQEPYSVQATAAIAAVITFLILFTIFGNSLVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDPGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSHRRGPRAKGGPGKGESKQPRPVPGEVSASAKLPTLVSQ
LATAGETNGCSQHTGEKDEGETSEDTGTPALPPSWPALPSSGQGQKEGVCGTSPEEEAEE
EEEEECEPQTLPASPASACSPPLQQPQGSRVLATLRGQVLLGRGMGTSSGQWWRRRAQLT
REKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPV
IYTIFNQDFRRAFRRILCRQWTQTAW
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggagccctactccgtgcaggccactgcggccatcgctgcggtcatcacc
ttcctcatcctgttcactatcttcggcaactccctggtcatcttggctgtgctgacaagc
cgctcgctgcgcgcgccgcaaaacctgttcctagtgtcgctggccgcagccgacatcctg
gtggccacactcatcatccctttttcgctggccaatgagctgctgggctactggtacttt
cgacgcacctggtgtgaagtgtacctggcgctggacgtgcttttctgcacctcctccatc
gtgcacctgtgtgccatcagcctggaccgctactgggcagtgagccgcgcgttggagtac
aactccaagcgcaccccgcggcgcatcaagtgcatcatcctcaccgtgtggctcatcgca
gctgtcatctcgctgccgcctcttatctacaagggcgacccgggtccccagccccggggg
cgccctcaatgcaagctcaatcaagaggcctggtacatcctggcctccagcattggctct
ttctttgcaccctgccttatcatgatccttgtttacctgcgcatctacttgatcgctaag
cgcagccaccgcagaggccctagggctaaggggggccctgggaagggggagtctaagcag
ccccgcccagtccctggggaagtttcagcctcagccaagttgccaaccttggtctctcaa
ctggccactgctggagagaccaatgggtgctctcagcacactggggagaaggatgaaggg
gagacctctgaagacactgggacccccgctttgccacccagctggcctgcccttcccagc
tcgggccagggtcagaaggaaggtgtttgtggaacatcaccagaggaggaggctgaagag
gaggaggaggaggagtgtgagcctcagactttgccagcctctcctgcctcggcttgcagt
ccacccctgcagcagccacagggttcccgggtgctggcaaccctacggggccaggtgctc
ctgggcaggggcatgggcacttcgagtgggcagtggtggcgtcggcgggcgcagctgacc
cgggagaagcggttcacgttcgtgctggctgtggtcattggcgtgtttgtgctctgctgg
ttccccttcttcttcagctatagcctgggtgccatctgccctcagcactgcaaggtgccc
catggcctattccagttcttcttctggatcggctactgcaacagctcgctgaaccctgtc
atctacaccatcttcaaccaggactttcgtcgtgccttccgaaggatcctgtgccgccag
tggacccagacagcctggtga

DBGET integrated database retrieval system