KEGG   Sus scrofa (pig): 733606Help
Entry
733606            CDS       T01009                                 

Gene name
TMSB4X, TMSB4
Definition
thymosin beta 4, X-linked
Orthology
K05764  
thymosin, beta 4
Organism
ssc  Sus scrofa (pig)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    733606 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
X
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagattgagaaattcgataagtcgaaattgaagaag
acagaaacgcaagagaaaaatccactgccttcaaaagaaacgattgaacaggagaagcaa
gcaggcgagtcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system