KEGG   Sus scrofa (pig): 733609Help
Entry
733609            CDS       T01009                                 

Gene name
DBH, Tbh
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    733609 (DBH)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     733609 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1q2.13; 1
AA seq 610 aa AA seqDB search
MQVPGPSLREAASMYGTAVAVFLVILVAALQGSTPPESPFPYHIPLDPEGTLELSWNVSY
VQETVHFQLLVRELKAGVLFGMSDRGELENADLAVLWTDGDSAYFGDAWSDQKGQIHLDS
QQDYQLLRAQRTPEGLSLLFKRPFGTCDPKDYFIEDGTVHLVYGILEEPVRSLEAINTSG
LQTGLQRVQLLKPNISVPALPADLQTMEIRAPDILVPGQETTYWCYITELPEGFSRHHIV
MYEPIVTAGNEALVHHMEVFQCAAEFESFPAFSGPCDSKMKPERLNYCRHVLAAWALGAK
AFYYPEEAGLAFGGPGSSRFLRLEVHYHNPLMITGRRDSSGIRLYYTATLRRFDAGIMEL
GLVYTPVMAIPPQEPAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLARG
GREREVVNRDDHYSPHFQEIRMLKKVVSVLPGDVLITSCTYNTEDRKLATVGGFGILEEM
CVNYLHYYPQTQLELCKSAVDPGFLQKYFHLVNRFDSEQVCTCPQATVPEQFASVPWNSF
NRQVLRALYGFAPISMHCNKSSAVRFQGEWNLQPLPEITSKLEEPAPHCPPGRGQSPVGP
TVVSIGGGKG
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccccggccccagcctgcgcgaggcagcctccatgtacggcacggccgtggcc
gtcttcctggtcatcctggtggccgcgctgcagggctcgacaccccccgagagccccttc
ccctaccacatccccctggaccccgaggggaccctggagctgtcctggaatgttagctac
gtgcaggagacggttcacttccagctcctggtgcgggagctcaaggccggcgtcctgttc
gggatgtcggaccgcggcgagttggagaacgcagacctggccgtgctctggactgatggg
gacagcgcctattttggggatgcctggagtgaccagaaaggccagatccacctggattcc
cagcaggattaccagctgctgcgggcacagaggaccccggaaggcctgtccctgcttttc
aagaggccctttggcacctgtgaccccaaggattacttcatcgaggacggcacagtccac
ttggtgtacgggatcctggaggagccggtccggtccctggaggccatcaacacctcgggc
ctgcagacggggctgcagagggtgcagctgctgaaacccaacatctccgtgccggcgctg
cccgcggacctgcagaccatggagatccgcgccccggacatcctggtccccggccaggag
accacgtactggtgctacatcaccgagctcccggagggcttctcccggcaccacatcgtc
atgtacgagcccattgtcaccgcgggcaacgaggccctggtgcaccacatggaggtcttc
cagtgcgccgcggagttcgagagcttccccgctttcagcgggccctgcgactccaagatg
aagccggagcgcctcaactactgccgccacgtgctcgccgcctgggccctgggcgccaag
gccttctactacccagaggaagctggccttgcttttgggggccccgggtcctcccgattt
ctccgcctggaagttcactatcacaacccgctgatgataacaggccgacgggactcctcg
ggcatccgcctctactacacggccacgctgcggcgcttcgatgcggggatcatggagctg
ggcctggtgtacacgcccgtgatggccatccccccgcaggagccggccttcgtcctcacg
ggctactgcacggacaagtgcacccagctggctctgcctccctctgggatccacatcttc
gcctcacagctccacacgcacctgacaggcaggaaggtggtcacggtgctggcccgcggc
ggccgcgagagggaggtggtgaacagagacgaccactacagcccccacttccaggagatc
cgcatgctcaagaaggtcgtgtctgtcctcccgggagacgtgctcatcacctcgtgcaca
tacaacacggaagaccggaagctggccaccgtggggggctttgggatcctggaggagatg
tgtgtcaattacctacactactacccccagacgcagctggagctctgcaagagcgccgtg
gaccctggcttcctgcagaagtatttccaccttgtcaacaggttcgacagcgagcaagtc
tgcacctgccctcaggccaccgtccccgagcagtttgcctctgtgccctggaactcgttc
aaccgccaagtgctcagggccttgtacggcttcgcccccatctccatgcactgcaacaag
tcctcggccgtgcgcttccagggtgagtggaacctgcagcccctgcccgaaatcacctcc
aagctggaagagcctgccccacactgcccacccggccggggtcagagccccgtgggcccc
accgtggtcagcatcggtgggggcaaagggtga

DBGET integrated database retrieval system