KEGG   Sus scrofa (pig): 733640Help
Entry
733640            CDS       T01009                                 

Gene name
PRKG1, Prkg1beta
Definition
protein kinase, cGMP-dependent, type I (EC:2.7.11.1)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
ssc  Sus scrofa (pig)
Pathway
Gap junction
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Class
Cellular Processes; Cell communication; Gap junction [PATH:ssc04540]
Organismal Systems; Digestive system; Salivary secretion [PATH:ssc04970]
Organismal Systems; Nervous system; Long-term depression [PATH:ssc04730]
Organismal Systems; Sensory system; Olfactory transduction [PATH:ssc04740]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:ssc04713]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPIFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggaggaagactttgccaagattctcatgctcaaagaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaatccaggagctgaagaggaagctc
cataaatgtcagtcggtgctgcccgtgccctcgacccacatcggcccccggaccacccgg
gcacagggcatctcggccgagccgcagacgtacaggtccttccacgacctccgacaggca
ttccggaagttcaccaaatccgaaaggtccaaggatcttataaaggaagctatccttgac
aatgactttatgaagaacttggagctgtcacagatccaagagattgtggattgtatgtac
ccagtggagtacggcaaagacagttgcatcattaaagaaggcgatgtggggtccctggtg
tatgtcatggaagatggtaaggttgaagttacaaaggaaggtgtgaagctgtgcacgatg
ggtccaggaaaagtatttggggagttggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtgaaactctgggccattgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtatatggaatttttaaaaagcgttcca
acattccagagccttcctgaagagatccttagtaagcttgctgacgtccttgaagagacc
cactatgaaaatggggaatatatcatcaggcaaggtgcaagaggggacaccttctttatc
atcagcaaaggaaaggtaaatgtcactcgtgaagactcaccaagtgaagatcccatcttt
cttagaactttaggaaaaggagattggtttggagagaaagccttgcagggggaagatgtg
agaacagcaaatgtaattgctgcggaagctgtaacctgccttgtgatcgacagagattct
ttcaagcatttgattggaggattggatgatgtgtctaataaagcctatgaagatgcagaa
gctaaagcaaaatatgaagctgaagctgctttcttcgccaacctgaagctgtctgatttc
aacatcattgacacccttggagttggaggttttggacgagtagaactggtccagttgaaa
agtgaagaatccaaaacctttgcaatgaagattctcaagaaacgccatatcgtggataca
agacagcaggagcacatccgctctgagaagcagatcatgcagggggctcattctgatttc
atagtgagattatacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgcttaggtggagagctctggaccattctcagggatcgaggctcatttgaagattctaca
acccgattttatacagcatgtgtggtagaagcctttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagagtacgtagccccagagatcatcttgaacaaaggccatgacatttcagccgac
tactggtcactgggaatcctaatgtatgaacttctgactggcagcccacccttctcaggc
ccagatcctatgaaaacctataacatcatattaagggggattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggataatccatca
gaaagattgggtaatttgaaaaatggagtgaaagacatccagaagcacaagtggtttgag
ggctttaattgggaaggcttaagaaaaggcaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagcaattttgacagtttccctgaggacagtgatgaaccacca
cctgatgacaactcaggatgggacatagacttctaa

DBGET integrated database retrieval system