KEGG   Sus scrofa (pig): 733640Help
Entry
733640            CDS       T01009                                 

Gene name
PRKG1
Definition
(RefSeq) cGMP-dependent protein kinase 1
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04022  cGMP-PKG signaling pathway
ssc04270  Vascular smooth muscle contraction
ssc04540  Gap junction
ssc04611  Platelet activation
ssc04713  Circadian entrainment
ssc04714  Thermogenesis
ssc04730  Long-term depression
ssc04740  Olfactory transduction
ssc04923  Regulation of lipolysis in adipocytes
ssc04970  Salivary secretion
Module
ssc_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    733640 (PRKG1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    733640 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    733640 (PRKG1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    733640 (PRKG1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    733640 (PRKG1)
  Digestive system
   04970 Salivary secretion
    733640 (PRKG1)
  Nervous system
   04730 Long-term depression
    733640 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    733640 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    733640 (PRKG1)
   04714 Thermogenesis
    733640 (PRKG1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     733640 (PRKG1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  PKG family
   733640 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr PKcGMP_CC Kinase-like Wtap APH Atg14 Pkinase_C Tnp_22_trimer Med4 OmpH IncA
Motif
Other DBs
NCBI-GeneID: 733640
NCBI-ProteinID: NP_001038039
UniProt: Q3YJM5
Position
14
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPIFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggaggaagactttgccaagattctcatgctcaaagaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaatccaggagctgaagaggaagctc
cataaatgtcagtcggtgctgcccgtgccctcgacccacatcggcccccggaccacccgg
gcacagggcatctcggccgagccgcagacgtacaggtccttccacgacctccgacaggca
ttccggaagttcaccaaatccgaaaggtccaaggatcttataaaggaagctatccttgac
aatgactttatgaagaacttggagctgtcacagatccaagagattgtggattgtatgtac
ccagtggagtacggcaaagacagttgcatcattaaagaaggcgatgtggggtccctggtg
tatgtcatggaagatggtaaggttgaagttacaaaggaaggtgtgaagctgtgcacgatg
ggtccaggaaaagtatttggggagttggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtgaaactctgggccattgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtatatggaatttttaaaaagcgttcca
acattccagagccttcctgaagagatccttagtaagcttgctgacgtccttgaagagacc
cactatgaaaatggggaatatatcatcaggcaaggtgcaagaggggacaccttctttatc
atcagcaaaggaaaggtaaatgtcactcgtgaagactcaccaagtgaagatcccatcttt
cttagaactttaggaaaaggagattggtttggagagaaagccttgcagggggaagatgtg
agaacagcaaatgtaattgctgcggaagctgtaacctgccttgtgatcgacagagattct
ttcaagcatttgattggaggattggatgatgtgtctaataaagcctatgaagatgcagaa
gctaaagcaaaatatgaagctgaagctgctttcttcgccaacctgaagctgtctgatttc
aacatcattgacacccttggagttggaggttttggacgagtagaactggtccagttgaaa
agtgaagaatccaaaacctttgcaatgaagattctcaagaaacgccatatcgtggataca
agacagcaggagcacatccgctctgagaagcagatcatgcagggggctcattctgatttc
atagtgagattatacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgcttaggtggagagctctggaccattctcagggatcgaggctcatttgaagattctaca
acccgattttatacagcatgtgtggtagaagcctttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagagtacgtagccccagagatcatcttgaacaaaggccatgacatttcagccgac
tactggtcactgggaatcctaatgtatgaacttctgactggcagcccacccttctcaggc
ccagatcctatgaaaacctataacatcatattaagggggattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggataatccatca
gaaagattgggtaatttgaaaaatggagtgaaagacatccagaagcacaagtggtttgag
ggctttaattgggaaggcttaagaaaaggcaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagcaattttgacagtttccctgaggacagtgatgaaccacca
cctgatgacaactcaggatgggacatagacttctaa

DBGET integrated database retrieval system