KEGG   Sus scrofa (pig): 733640Help
Entry
733640            CDS       T01009                                 

Gene name
PRKG1, Prkg1beta
Definition
protein kinase, cGMP-dependent, type I (EC:2.7.11.1)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
ssc  Sus scrofa (pig)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    733640 (PRKG1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    733640 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    733640 (PRKG1)
  Digestive system
   04970 Salivary secretion
    733640 (PRKG1)
  Nervous system
   04730 Long-term depression
    733640 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    733640 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    733640 (PRKG1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     733640 (PRKG1)
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   733640 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPIFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggaggaagactttgccaagattctcatgctcaaagaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaatccaggagctgaagaggaagctc
cataaatgtcagtcggtgctgcccgtgccctcgacccacatcggcccccggaccacccgg
gcacagggcatctcggccgagccgcagacgtacaggtccttccacgacctccgacaggca
ttccggaagttcaccaaatccgaaaggtccaaggatcttataaaggaagctatccttgac
aatgactttatgaagaacttggagctgtcacagatccaagagattgtggattgtatgtac
ccagtggagtacggcaaagacagttgcatcattaaagaaggcgatgtggggtccctggtg
tatgtcatggaagatggtaaggttgaagttacaaaggaaggtgtgaagctgtgcacgatg
ggtccaggaaaagtatttggggagttggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtgaaactctgggccattgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtatatggaatttttaaaaagcgttcca
acattccagagccttcctgaagagatccttagtaagcttgctgacgtccttgaagagacc
cactatgaaaatggggaatatatcatcaggcaaggtgcaagaggggacaccttctttatc
atcagcaaaggaaaggtaaatgtcactcgtgaagactcaccaagtgaagatcccatcttt
cttagaactttaggaaaaggagattggtttggagagaaagccttgcagggggaagatgtg
agaacagcaaatgtaattgctgcggaagctgtaacctgccttgtgatcgacagagattct
ttcaagcatttgattggaggattggatgatgtgtctaataaagcctatgaagatgcagaa
gctaaagcaaaatatgaagctgaagctgctttcttcgccaacctgaagctgtctgatttc
aacatcattgacacccttggagttggaggttttggacgagtagaactggtccagttgaaa
agtgaagaatccaaaacctttgcaatgaagattctcaagaaacgccatatcgtggataca
agacagcaggagcacatccgctctgagaagcagatcatgcagggggctcattctgatttc
atagtgagattatacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgcttaggtggagagctctggaccattctcagggatcgaggctcatttgaagattctaca
acccgattttatacagcatgtgtggtagaagcctttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagagtacgtagccccagagatcatcttgaacaaaggccatgacatttcagccgac
tactggtcactgggaatcctaatgtatgaacttctgactggcagcccacccttctcaggc
ccagatcctatgaaaacctataacatcatattaagggggattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggataatccatca
gaaagattgggtaatttgaaaaatggagtgaaagacatccagaagcacaagtggtttgag
ggctttaattgggaaggcttaagaaaaggcaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagcaattttgacagtttccctgaggacagtgatgaaccacca
cctgatgacaactcaggatgggacatagacttctaa

DBGET integrated database retrieval system