KEGG   Sus scrofa (pig): 768115Help
Entry
768115            CDS       T01009                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTPSVYFMKQTISNACGTIGLIHAIANNKNKMHFESGSTLK
KFLEESASMSPDERARYLESYDAIPVTHETSAHEGQTEAPNIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcagcgctggctgccgctggaggccaatcccgaggtcaccaaccagtttctc
aaacaactaggtctgcatcctaactggcaatttgttgatgtatatggaatggatcctgaa
ctccttagcatggtaccaagaccagtgtgtgcagtgttgcttctcttccctattacagaa
aagtatgaagtattcagaacagaagaagaggaaaaaataaaatctcagggacaagatgtt
acaccgtcagtatatttcatgaagcaaaccatcagcaatgcctgtggaacaattgggcta
atccatgctattgccaacaataaaaacaagatgcactttgaatctggatcaaccttgaaa
aaattcctagaggagtctgcatcaatgagccccgacgaacgagccagatacctggaaagc
tatgatgccattcccgttactcacgagaccagtgcccatgaaggtcagactgaggcacca
aatatagatgaaaaagtagatcttcactttattgcattagttcacgtagatgggcatctc
tatgaattagatggacggaaaccatttccaattaaccatggggaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggaacgtgaccctgatgaactg
agattcaatgcaattgctctttctgcagcatag

DBGET integrated database retrieval system