KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0158Help
Entry
SPSINT_0158       CDS       T01396                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ssd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
176076..176924
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINLTLDTLYKRDDGYHEVEMIMTTIDLSDRLSFEKRNDSRIVLKVDETFIP
SDDRNLAYRAALLMKETYQIKQGVTITLEKNIPVAAGLAGGSSDAAATMRGMNRLFELNR
SLDELSELSAAIGSDVPFCVYGTTALCKGRGEILEILPKTPSAWVIVAKPQAGLSTPEIY
GGLDLSQPFPVHTEQCLKAIEENDYDALCKSLSNRLEPVSMQLQPEIAKIKTNMLNNGAD
GALMSGSGPTVYGFAQRERQARHIFNAVSGCCNDVYLVRTLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgaaacagcgcctgctaaaatcaatttgacattagatactttgtacaaaaga
gatgacggttatcatgaagttgaaatgattatgacaacaatcgatttgagcgatcggtta
tcatttgagaaaagaaatgattcacgtatcgttttaaaggttgatgaaacgtttattccc
tctgatgatcgtaatttagcttatcgagcagcacttttgatgaaagaaacttaccaaatt
aagcaaggtgtaacgattacattagaaaagaacattcctgtcgcagcagggcttgcagga
ggctcaagtgatgcagcagcaaccatgcgtggtatgaatcgtttgtttgaattaaatcgc
tcacttgatgaattgagcgagctttctgcggcgattggttcggatgtgccattttgtgtg
tacggcactacggcactttgtaaaggacgtggtgaaattctcgagattttaccgaaaacg
ccttcagcttgggtcattgttgctaaaccacaagccggcttatcgacaccagagatttat
ggtggtttagatttgagtcaacctttcccagttcatacagagcaatgtttaaaagctatt
gaagagaatgactatgatgcgctatgcaaaagtttgtctaaccgcttagagcctgtttct
atgcaactccaaccggaaattgctaaaattaaaacaaatatgctcaataacggtgcggac
ggtgcattgatgagtggtagcggcccgacagtatatggttttgcacaacgcgaacgccaa
gcccgccatatttttaatgcagtgagcggttgttgtaatgatgtctatctcgtaaggaca
ctggggtaa

DBGET integrated database retrieval system