KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0177Help
Entry
SPSINT_0177       CDS       T01396                                 

Definition
(RefSeq) dihydropteroate synthase (EC:2.5.1.15)
  KO
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPSINT_0177
Enzymes [BR:ssd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SPSINT_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197610..198413
Genome map
AA seq 267 aa AA seqDB search
MPQTQIMGILNVTPDSFSDGGRFNEVDRAVEHGTKMVEQGAHIIDVGGVSTRPGHEEVTE
EVTVEEELARVIPVVKALQHLDVTISVDTFRSEVAEAALEAGATMINDQWAGLYDSRMFQ
VVAKYDAEVILMHNGDGERNVPVMDEMLVMLLKQANKAVLAGIDRERIWLDPGIGFATTR
EEEQEVMSRLDELVATGYKVLLATSRKRLIKFLLGGDNQVDERDEATAATTAYGIMKGVH
GVRVHNVLMNARLAKTMDALKGYEDGR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaacacaaattatgggtattttaaatgtcacaccggattcgttttcagatggt
gggcgctttaatgaagttgatcgcgcggttgaacatgggactaagatggttgaacaaggc
gcacatatcattgatgtaggaggcgtatccacacgtccaggtcacgaggaagtcacagag
gaagtcacagtggaggaagaacttgcacgtgtcatcccggtcgttaaagctttacaacat
ttggacgtcactatttcagtcgatacatttcgaagcgaagttgcagaagctgcacttgaa
gcgggtgctacaatgattaatgatcagtgggcagggctttatgattcacgcatgtttcaa
gtggttgcgaaatacgacgcagaagtcattttaatgcataatggtgatggcgagcggaac
gtaccggtgatggacgaaatgcttgtcatgttattaaagcaagcgaataaagcggtgctc
gccgggattgatcgtgaacgtatttggcttgatccgggtattggatttgcgacaacgcgt
gaagaagaacaagaagtgatgtcacggttagatgaacttgttgcaacaggttataaagtt
ttgttagcgacgagtcgaaagcgtttgattaaatttttactcggtggcgacaatcaagtt
gatgagcgcgatgaagcgacggcagccacaacagcttacggtattatgaaaggtgtacat
ggtgttcgtgtacataatgttttaatgaatgcacgattggccaaaacaatggatgcgttg
aaaggatatgaagatggaagataa

DBGET integrated database retrieval system