KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0179Help
Entry
SPSINT_0179       CDS       T01396                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPSINT_0179
Enzymes [BR:ssd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SPSINT_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
198767..199252
Genome map
AA seq 161 aa AA seqDB search
MIDVYLGLGSNMGDREAQLKAAIDLLDAHDKINVVAISPIYETKPVGYTEQPDFLNLCLH
IQTQLSAQDLLKVALETEAELHRVRKVRWGPRTMDIDILLYGDEIIEEDDLTVPHPRMTE
RAFVMVPLNDIAANVTEPHSGQKIQQIVPHDDTVVKYKAIL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtgtatttaggtttaggcagtaacatgggtgaccgagaagcacagttaaaa
gcagcgattgatttattagatgctcatgacaagattaatgttgttgcgatttcacctatt
tatgaaacgaagccggtcggatatacagaacaacctgattttttgaatttatgcttacac
attcaaacacaactttctgcacaagacttgttaaaggtcgctttagaaactgaggcagag
ttacatcgtgtacgtaaagtgcgatggggcccacgtacaatggatattgacattttattg
tacggcgatgaaatcattgaagaggatgatttaacggtgccgcacccgcgtatgactgaa
cgtgcttttgtgatggtaccattaaatgatattgctgccaatgttaccgaaccgcattcg
ggccaaaaaattcaacagatcgtacctcatgatgatacagtagtaaaatataaagcaata
ttgtga

DBGET integrated database retrieval system