KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0236Help
Entry
SPSINT_0236       CDS       T01396                                 

Definition
Deoxyadenosine kinase / Deoxyguanosine kinase (EC:2.7.1.113 2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPSINT_0236
   00240 Pyrimidine metabolism
    SPSINT_0236
Enzymes [BR:ssd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SPSINT_0236
    2.7.1.76  2'-deoxyadenosine kinase
     SPSINT_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(272001..272666)
Genome map
AA seq 221 aa AA seqDB search
MNQYNIPSNAIITIAGTVGVGKSSLTRAIAEKLNFRTSYENVEHNPYLDKFYHDFKRWSF
HLQMYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHVEQGTMTPEDFKTYSNLFE
AMVLTPYFPKPDVLIYLESDYEAVLERIQARGRQMEIETDPEYWEMLFQRYENWINQFNA
CPVVRVNINEYDLLSHPESVDVVLKKIGHVIHTYRQVDQRS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatataatataccctcaaacgcgattattaccattgccggtactgtcggcgtt
ggcaaatcatctttaacccgcgcaatagcagaaaaacttaattttagaacatcttatgaa
aatgtagaacataatccctatttagataaattttatcatgatttcaaacgttggagcttt
catttacagatgtactttttagcagaacgctttaaagagcaaaaacgtatgtttgagtat
gggggtggctttgttcaagaccgttcaatttatgaagatgtcgatatctttgcaaagatg
catgtagaacaaggtacaatgacgcctgaagatttcaaaacatactccaacctttttgaa
gcaatggtgttaacgccctatttccctaaacctgacgtcctcatttacctcgagtcagat
tatgaagcagttcttgaacgcatccaagcacgtgggcgtcaaatggaaatcgaaacagat
cctgaatattgggaaatgctgttccaacgttatgagaattggattaaccaatttaatgct
tgtcctgttgttcgtgtaaatattaatgaatatgatttattgagtcaccctgaatcggtc
gatgtggtattgaaaaaaatcggtcatgtgatccatacctatagacaagtcgatcaacgt
tcataa

DBGET integrated database retrieval system