KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0258Help
Entry
SPSINT_0258       CDS       T01396                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPSINT_0258
   01230 Biosynthesis of amino acids
    SPSINT_0258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSINT_0258
  Energy metabolism
   00680 Methane metabolism
    SPSINT_0258
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPSINT_0258
Enzymes [BR:ssd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPSINT_0258
Exosome [BR:ssd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPSINT_0258
  Exosomal proteins of melanoma cells
   SPSINT_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294305..294991
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSVWNAENLFTGWADVDLSEQGHNEAITSGKKLKEQEIQIDIAFTSLLKR
AIKTTFHLLNESDQLYVPVVKSWRLNERHYGGLQGLNKDEARQQFGEEQVHIWRRSYDTP
PPAQDEAQRERYLKDRKYELLDRRVMPESESLKDTLVRVIPYWNDQISQELLADKTVLVA
AHGNSLRALIKYLEGVSDEDIVGYEIKTGAPLIYELTDDLKVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacttattttatgtagacacggacaaagcgtctggaatgctgaaaacttattt
acaggatgggcagacgtcgatttatccgaacaaggtcacaacgaagccatcacatcagga
aaaaaattgaaagaacaagaaattcagattgatattgcatttacctcgttattaaagcgt
gcgattaagaccacgtttcatttattaaatgagtctgatcaactctacgtacccgttgtt
aaatcgtggcgtttaaatgaacgtcattacggtggtttacaaggattaaataaagatgaa
gcacgtcagcaatttggtgaagaacaagtccatatttggagacgttcttacgatacacct
ccgccagcacaagatgaagcacaacgcgagcgctatttaaaagatcgcaaatacgaatta
ttagatagacgcgtgatgcctgaatctgaaagtttgaaagatactttggtgcgtgtcatc
ccatattggaacgaccaaatttctcaagaattattagctgataaaacagtacttgtagcg
gcccatggaaactcattacgtgctttgattaaatatttagaaggcgtatcagatgaagat
atcgtcggctatgaaattaaaacaggtgcgccactgatttacgaattgacagatgattta
aaagttattgacaaatattatttataa

DBGET integrated database retrieval system