KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0260Help
Entry
SPSINT_0260       CDS       T01396                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPSINT_0260
   00630 Glyoxylate and dicarboxylate metabolism
    SPSINT_0260
   00640 Propanoate metabolism
    SPSINT_0260
   00650 Butanoate metabolism
    SPSINT_0260
  Lipid metabolism
   00071 Fatty acid degradation
    SPSINT_0260
   00072 Synthesis and degradation of ketone bodies
    SPSINT_0260
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPSINT_0260
   00310 Lysine degradation
    SPSINT_0260
   00380 Tryptophan metabolism
    SPSINT_0260
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPSINT_0260
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPSINT_0260
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPSINT_0260
Enzymes [BR:ssd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPSINT_0260
Exosome [BR:ssd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPSINT_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
296548..297693
Genome map
AA seq 381 aa AA seqDB search
MTKAVIVAAKRTPIGVYGGQLQKWEPEHLLKPLFEHFEVTLSCSLNDLDDVILGNIVGKG
GNIARKSLLEAGIDVSVPGLTVDRQCGSGLEAIHLASRLVESGAGDFYIAGGVESTSRAP
WKMEKPTSLYPTTPPTFYERAPFAPVGQDPTMIEAADNVAKQYDVSREDQDRFAVQSHHR
ASKAIATGAMSAEILPLIVKGQQMIQDESVKPHLQYERIARLKPLREGGTVTVGNCCLKH
DGACLVVVMSEQKARELGMSEGLMFMDYAVEGVDPHVLGIGPVPAVQRILERQQRTIDQI
DAVELNEAFSAQVLASARALNIQEAQLNRYGGAIAIGHPYSASGAILVTRLFYMKDAQST
IATMGIGGGMGNAALFERWRP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagcagtcattgttgcagcaaaacggacaccaattggcgtgtatggcggtcaa
cttcaaaaatgggagccggagcatctactgaaaccgttattcgaacattttgaagtgaca
ttatcttgttcactcaatgatttagatgacgtcattctcggtaatattgtcggtaaaggg
ggcaatattgcgcgaaaaagtttgctcgaggcagggatagatgtgtctgttccaggtctc
acggttgatcgtcaatgcggttcgggccttgaagcaattcatttggcgagtcgactcgtt
gaaagcggtgcaggagacttttatattgcagggggtgtcgaaagtacgagtcgtgcacct
tggaaaatggaaaagccgacatcactgtatccaacgacacctccgacattttatgagcgt
gcgccatttgcgccagtaggtcaagatccgactatgattgaagcggcagacaacgtggca
aaacagtatgatgtgtcacgtgaagaccaagatcgttttgcggttcaaagccatcatcgt
gcaagtaaagcgattgcgacaggtgcgatgtcagctgaaatattgccactaatagtgaaa
ggtcagcaaatgatacaagatgaaagtgttaagccgcatcttcagtatgagcggattgca
cggttaaagccattacgtgaaggtgggacagtgacagtcggtaattgttgtctcaaacac
gacggcgcctgtctagttgtcgtcatgtctgaacaaaaagcacgcgaactcggtatgtcg
gaaggtctgatgtttatggattatgcggttgaaggggtggatccacatgtattaggcatc
ggtcctgtacccgcagtgcagcgcattttagaacgacaacaacggacgatagaccaaatt
gatgccgtagaattgaatgaagcttttagcgcgcaagtgttagcgtctgcacgtgcgttg
aacattcaagaggcgcaattgaatcgttacggtggtgcgattgcgatcggtcatccgtat
agtgcgagtggtgcgattttagtgacccgtctgttttacatgaaagatgcacaaagtacc
attgcgacaatgggcattggagggggcatgggcaatgcagcactttttgaacgttggcga
ccgtga

DBGET integrated database retrieval system