KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0489Help
Entry
SPSINT_0489       CDS       T01396                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00010  Glycolysis / Gluconeogenesis
ssd00051  Fructose and mannose metabolism
ssd00562  Inositol phosphate metabolism
ssd01100  Metabolic pathways
ssd01110  Biosynthesis of secondary metabolites
ssd01120  Microbial metabolism in diverse environments
ssd01130  Biosynthesis of antibiotics
ssd01200  Carbon metabolism
ssd01230  Biosynthesis of amino acids
Module
ssd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssd_M00002  Glycolysis, core module involving three-carbon compounds
ssd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSINT_0489
   00051 Fructose and mannose metabolism
    SPSINT_0489
   00562 Inositol phosphate metabolism
    SPSINT_0489
Enzymes [BR:ssd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPSINT_0489
Exosome [BR:ssd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPSINT_0489
  Exosomal proteins of bladder cancer cells
   SPSINT_0489
  Exosomal proteins of melanoma cells
   SPSINT_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADV05018
Position
536741..537502
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTVQEAKDFVQTLPALPDTNEVEAVICAPTIQLDALISLTKENVAPG
LKIGAQNTYFEESGAFTGETSPVALEALGVSYVVIGHSERRDLFHETDEDINKKAHAVFN
HNMTPIICVGESDEERESGKANEIVEAQVEKALKGLSDEQIKKVVIAYEPIWAIGTGKSS
TAKDANEMCAAVRQKIAKLTSDEVAQATRIQYGGSVKPGNIKEYMAETDIDGALVGGASL
KVEDYTQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaccaatcatcgcaggtaactggaaaatgaacaaaactgtacaagaagcgaaa
gattttgtacaaacgttaccagcattaccagatacaaatgaagttgaggcagtgatttgt
gcacctacaattcaacttgatgcactgatttcattaacaaaagaaaatgttgcgccaggt
cttaaaatcggtgcgcaaaacacttattttgaagagagtggtgcgtttacaggggaaaca
tctccagtcgcattagaagcattaggtgtgagctacgttgtcatcggtcactctgaacgt
cgtgacttattccacgaaactgatgaagatattaacaaaaaagcgcatgcagtgtttaac
cacaacatgacaccaatcatttgtgtcggtgaatcagatgaagaacgtgaaagtggtaaa
gcaaacgaaatcgttgaagcccaagttgaaaaagcgttaaaaggtttatcagatgaacaa
attaaaaaagttgttatcgcctatgaaccaatttgggcgattggtacaggtaaatcttca
acagcgaaagatgcgaacgaaatgtgtgcagcggtccgtcaaaaaatcgcgaagttaaca
agtgatgaagtagcacaagcaacacgtattcaatacggtggtagtgtaaagccaggcaat
attaaagaatatatggctgaaactgatattgatggcgcattagttggtggtgcatcactt
aaagtagaagattatactcaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system