KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0765Help
Entry
SPSINT_0765       CDS       T01396                                 

Definition
quinol oxidase polypeptide I QoxB
Orthology
K02827  
cytochrome aa3-600 menaquinol oxidase subunit I [EC:1.10.3.12]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome aa3-600 menaquinol oxidase
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:ssd00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(805385..807376)
Genome map
AA seq 663 aa AA seqDB search
MMDFPWNELIVKGNWMITLAQISAPFLVIGVIAAITYFKLWGYLYKEWFMSVDHKKIGLM
YLICAVLMFVRGGIDAILLRIQLTVPDNPFLESNHYNEIFSTHGVIMIIFMAMPLVIGLM
NIIIPLQIGARDVAFPVLNNISFWLFVAGMLLFNLSFIVGGSPAAGWTNYAPLAGEFSPG
PGVNYYLIAIQISGIGTLATGVNFFVTIIRLKSPSMTFMQMPMFVVTTFITMLIIILAFP
VLTVALALMTADRVFDTAFFTVANGGMPMLWANFFWVWGHPEVYILVLPAFGIYSEIIPT
FARKRLFGHQSMVWATAGIAFLSFLVWVHHFYTMGNGALVNSFFSITTMLIAVPTGVKIF
NWLFTLHKGRISFESPMLFSLAFIPNFTIGGVTGVMLAMASADFQYHNTYFLVAHFHYTI
VAGVVFACFAAMIFWYPKAMGYKLFEKPNKWFFWIFMVGFNVTFLPQFILGLDGMPRRLY
TYMPEDGWFVLNVISSIGAAMMSIAFLIFVGNIVYSHLKAPREATGDNWNGLGRGLEWST
ASAIPPKYNFAITPDWDDIDTFVEMKKQGRHYLDNHNYSDIHMPNDTHIGFWMGIFFFIG
GFFLVFETLLPAILALAGIFGLMIWRSFQQDHGYHIPASEVAETEARLRKARQKEREAMN
HES
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgatggactttccatggaatgagcttattgtaaaaggtaactggatgattacattggct
caaatcagtgcacctttcttagttatcggtgtcattgcagccattacttactttaagctc
tggggatatttatataaggaatggttcatgtcagtcgaccacaaaaaaatcggtttgatg
tacttaatctgtgcggtattaatgttcgtacgtggtggtattgatgcaattctattacgt
attcaattaacagtacccgacaacccattcttagagtcaaatcactataacgaaattttc
tcaacgcacggtgtcatcatgattattttcatggcaatgccacttgtaatcggtctaatg
aacatcattatcccattacaaatcggtgctcgtgacgttgctttcccagtattgaacaac
attagcttttggttgttcgtagcgggtatgcttttatttaacctttcattcatcgtgggt
ggttctccagctgcaggttggacaaactatgcgccgcttgccggtgaattcagtcctgga
cctggtgtcaactattatttaattgccattcagatttcaggtattggtactttagcaacg
ggtgtgaacttcttcgtaacaatcatccgtctaaaatcaccaagtatgacatttatgcaa
atgccaatgttcgttgtgacaacatttatcacaatgttaatcatcatcttggcattccca
gtgttaactgtagcacttgcattaatgactgctgacagagtgtttgatactgcattcttc
acagtagctaatggcggtatgccgatgttatgggcaaacttcttctgggtatgggggcac
cctgaagtatacatccttgtccttccagcattcggtatttattcagaaattattccaaca
tttgcacgtaaacgtttatttggacaccaaagtatggtgtgggcaacagctggtatcgca
ttcttgagtttcttggtttgggttcaccatttctatacaatgggtaatggtgcattagtt
aactcattcttctctatcacaacaatgttgatcgctgtgccaactggtgtaaaaatcttt
aactggttatttacactacacaaaggacgtatttcatttgaatcgccaatgttattctca
ttagcgtttattcctaactttacaattggtggggttaccggggttatgcttgcgatggca
tccgcagacttccaataccacaacacatatttcttagtggcacacttccactatacaatt
gttgccggtgttgtatttgcatgtttcgcagctatgattttctggtatccaaaagctatg
ggttacaaattattcgaaaaaccaaacaaatggttcttctggatcttcatggttggtttc
aacgtgacattcttaccacaattcattttaggtcttgatggtatgccacgtcgtttatac
acttacatgccagaagatggttggtttgtattaaacgtgatttcttcaatcggtgctgca
atgatgtcgattgcgttcttaatctttgtaggtaacattgtatacagtcacctcaaagca
ccacgtgaagcaactggtgataactggaacggtttaggtcgtggtttagagtggtctact
gcatctgcaattccacctaaatacaactttgcaattacacctgattgggatgatattgat
acatttgttgaaatgaaaaaacaaggtagacactatcttgacaatcacaattacagcgac
attcacatgccgaacgatacacacatcggtttctggatgggtatctttttcttcatcggt
ggtttcttcttagtattcgaaacattattacctgcgattcttgcattagctggtatcttc
ggtttaatgatttggagaagtttccaacaagatcatggttaccacatccctgcaagtgaa
gtagctgaaactgaagcgcgcttgagaaaagctcgccaaaaagaaagggaggctatgaat
catgagtcataa

DBGET integrated database retrieval system