KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0804Help
Entry
SPSINT_0804       CDS       T01396                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPSINT_0804
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSINT_0804
   00020 Citrate cycle (TCA cycle)
    SPSINT_0804
   00620 Pyruvate metabolism
    SPSINT_0804
Enzymes [BR:ssd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPSINT_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846071..847372
Genome map
AA seq 433 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLCEVQNDKSVVEIPSPVSGTVLEVL
VEEGTVAVVGDIIVKIDAPDAEEMEFKGGHSNDAPAKAEEAKEEAPQEEAAPAAQEAVEV
DENRQVKAMPSVRKYARDNNVNIKAVNGTGKNGRITKEDVDAYLNGGEQAATAQDTASAE
SSEASTAPAASAPAVSTEGEFPETTEKISAMRKAIAKAMVNSKHTAPHVTLMDEIDVQEL
WDHRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVQKHYWNIGIA
ADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTSDEMKGATCTISNIGSAGGQ
WFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIK
RLLNNPELLLMEG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatattggtgaaggtatccacgaaggtgaaatcgta
aagtggttcgttaaagctggagacactattgaagaagatgacgtactatgtgaagtacaa
aatgataaatcagttgtagaaatcccatcacctgtaagtggtacagtacttgaagtgtta
gttgaagaaggtactgtagctgttgtaggtgacatcattgttaaaatagatgcacctgac
gctgaagaaatggagttcaaaggcggacatagtaatgatgcgcctgcaaaagctgaagaa
gctaaagaagaagcacctcaagaagaagcggcaccagctgctcaagaagctgtagaagtg
gatgaaaacagacaagtaaaagcaatgccatcagtgcgtaaatatgcacgtgacaataat
gtgaacattaaagctgttaatggtacaggtaaaaatggtagaattactaaagaagatgta
gatgcatacttaaatggtggcgaacaagcagcgacagctcaagatactgcatcagctgaa
tcttcagaagcatcaactgcaccagcagcatcagcaccagcagtttcaactgaaggtgaa
ttccctgaaacaactgagaaaatctctgcaatgcgtaaagcaatcgcaaaagcaatggtg
aactctaagcatactgcacctcacgtaacattaatggacgaaattgatgttcaagagtta
tgggatcaccgtaagaaattcaaagaaattgcagctgaacaaggtactaaattaacattc
ttaccttatgttgttaaagctttagtatcagcattgaaaaaatacccagcacttaacact
tcatttaacgaagaagctggcgaagttgtacaaaaacattactggaacattggtatcgca
gcagacactgacagaggtcttttagtacctgttgttaaacatgctgaccgtaaatcaatc
ttccaaatctcagatgaaattaacgaacttgctgtcaaagctcgtgacggtaaattaaca
tctgacgaaatgaaaggtgcaacatgtacaattagtaacatcggttctgcaggtggccaa
tggttcacaccagttatcaaccacccagaagttgcaatcttaggtattggtcgaatcgct
caaaaaccaatcgttaaagatggcgaaatcgttgcagcacctgtgttagcattatcacta
agctttgaccacagacaaattgatggtgcaactggtcaaaacgcaatgaaccacatcaaa
cgtttattaaacaatccagaactattattaatggaggggtaa

DBGET integrated database retrieval system