KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0973Help
Entry
SPSINT_0973       CDS       T01396                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00020  Citrate cycle (TCA cycle)
ssd00640  Propanoate metabolism
ssd00660  C5-Branched dibasic acid metabolism
ssd01100  Metabolic pathways
ssd01110  Biosynthesis of secondary metabolites
ssd01120  Microbial metabolism in diverse environments
ssd01130  Biosynthesis of antibiotics
ssd01200  Carbon metabolism
Module
ssd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSINT_0973
   00640 Propanoate metabolism
    SPSINT_0973
   00660 C5-Branched dibasic acid metabolism
    SPSINT_0973
Enzymes [BR:ssd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SPSINT_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: ADV05501
Position
1025369..1026535
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFSAEEAVEKAKELDTDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVEAYANELLGKVLVTHQTGPEGKEVKRLYIEEGANIQKEYYVGFVIDRATDR
VTLMASEEGGTEIEEVAAKNPEKIFKETIDPVIGLAPYQARRIAFNINIPKESINKAVKF
LIALYNVFIEKDCSIVEINPLVLTGEGDVLALDSKINFDDNALFRHKDIVELRDLEEEDP
KEIEASKYDLSYIALDGNIGCMVNGAGLAMATMDTINHFNGNPANFLDVGGGATKEKVTE
AFKIILGDENVKGIFVNIFGGIMRCDIIAEGIVAAVKEVELTLPLVVRLEGTNVKEGKQI
LKDSGLAIEPANTMAEGAQKIVKLVNEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaaggaaaagaaatttttcgctcaatgggcgtagcagtacca
gaagggcgtgtggctttttctgctgaagaagctgttgagaaagcgaaagagttagacaca
gatgtatatgttgttaaagcgcaaatccatgcggggggacgtggtaaagctggtggtgtg
aaaatcgctaagtctttatcagaagttgaagcatatgcaaatgagttgcttggaaaagtt
ctcgtgacacaccaaacaggtcctgaaggtaaagaggtgaagcgtctttacattgaagaa
ggtgccaatatccaaaaagaatattatgtcggctttgttattgaccgtgcgacagaccgt
gtgactttaatggcgtctgaagagggtggcactgaaattgaagaagttgcagcgaaaaac
cctgaaaaaatcttcaaagaaacaattgacccagtgattggtttagcgccttatcaagca
cgccgtatcgcgtttaacatcaatattcctaaagaatcaattaacaaagcggttaagttt
ttaattgctttatataatgtattcattgaaaaagattgttcaatcgttgaaattaaccca
cttgttttaacgggtgaaggtgatgttttagcacttgactctaaaatcaactttgatgac
aacgcattattccgtcacaaagatatcgttgaattacgcgatttagaagaagaagatcca
aaagaaattgaagcttctaaatacgatttatcttatattgcattagacggtaatatcggt
tgtatggtgaacggtgcaggtttagcgatggcaacaatggatacgattaatcactttaat
ggtaacccagctaacttccttgacgtaggtggcggtgcaactaaagaaaaagttactgaa
gcgttcaaaattattttaggcgatgaaaacgttaaaggtattttcgttaatatctttggt
ggtattatgcgttgtgatattatcgctgaaggtattgtagcggcagtaaaagaagtggaa
ttaacattgccattagttgtacgtcttgaaggtacaaatgttaaagaaggtaaacaaatc
ttaaaagactcaggtttagcaattgaaccagcgaatacaatggctgaaggtgcacaaaaa
attgttaaacttgtaaacgaagcgtaa

DBGET integrated database retrieval system