KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1033Help
Entry
SPSINT_1033       CDS       T01396                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SPSINT_1033
Enzymes [BR:ssd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SPSINT_1033
Exosome [BR:ssd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPSINT_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094620..1096122
Genome map
AA seq 500 aa AA seqDB search
MGNYILSIDQGTTSSRAILFNEEGEIVGVAQREFKQHFPKSGWVEHDANEIWSSVLSVMA
SVLTENNVSANEVKGIGITNQRETTVVWDKETGRPIYNAIVWQSRQTQSICDALKQEGHE
QTFRDKTGLLLDPYFSGTKVKWILDKVDGAREKAAKGEILFGTIDTWLVWKLSGGRAHVT
DYSNASRTLMYNIHELKWDDELLELLDVPKAMLPEVKPSSEVYCETIDYHFFGQNVPIAG
IAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGEEAVKSGNGLLTTIAYGIDGKVNYA
LEGSIFVSGSAIQWLRDGLRMINSAPQSEDYAIRVDSTEGVYVVPAFVGLGTPYWDSDAR
GAIFGLTRGTEKEHFIRATLESLCYQTRDVIEAMAQDSGIEVNSLRVDGGAVKNNFLMQF
QSDLLNIEVERPEINETTALGAAYLAGIATGFWKDKSEIQRRWKLEKSFEPEMDQKESNR
LYKGWKKAVEATQVFKLDEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattacatcttatctattgaccaaggtacaacaagctcaagagcgattctattt
aatgaggaaggggaaatcgttggtgttgcacaacgtgaatttaaacaacatttcccaaaa
tcagggtgggtagaacatgatgcgaatgaaatttggtcatcagttttatcagtcatggcg
tctgtattgactgaaaataatgtatctgcaaatgaagttaaagggatcggtattacgaac
caacgtgaaacaacggtagtttgggataaagaaacaggtcgtccgatttataacgcaatc
gtatggcaatctcgtcaaacacaatcgatttgtgacgctttaaaacaggaaggtcatgaa
caaacatttagagataaaacaggtttactacttgatccatacttctcaggtacaaaagtt
aaatggattcttgacaaagttgacggtgcccgtgaaaaagctgcaaaaggcgaaatctta
ttcggtacaatcgatacttggcttgtttggaagttatcaggtggtcgtgcgcatgtaaca
gactattctaatgcgagtcgtacgttaatgtacaacatccatgaattaaaatgggatgac
gaattacttgaattgttagatgttcctaaagcgatgttacctgaagtgaaaccatcaagt
gaagtttattgtgaaacgattgattatcacttcttcggtcaaaacgtaccgattgcaggt
attgctggtgaccaacaagccgcattattcggccaagcatgttttgaacgtggtgacgtg
aaaaatacttatggtacaggtggctttatgttaatgaacacaggtgaagaagcggttaaa
tctggtaacggtttattaacaacgattgcttacggtatcgatggtaaagtgaactatgcg
cttgaaggttcaattttcgtgtcaggttctgctattcaatggttaagagatggtctccgt
atgattaactcagcaccacaatctgaagactatgcaatacgtgttgattcaacggaaggt
gtatatgtcgtgccagcatttgttggtttaggtacaccatattgggattctgacgcacgt
ggcgctattttcggtttaacacgtggtactgaaaaagaacactttatccgtgcaacatta
gaatcattatgttatcaaacacgtgacgttatcgaagcgatggcacaagactcaggcatc
gaagtgaatagtttacgtgttgacggtggcgcagtgaaaaacaatttcttaatgcagttc
caatcagacttattaaacattgaagttgagcgtccagaaatcaatgaaacgacagcactt
ggcgcagcttatttggcaggtattgcgacaggcttctggaaggataaatctgaaattcaa
agacgttggaaattagaaaaatcattcgaaccagaaatggatcaaaaagaaagcaaccgt
ctatacaaaggttggaaaaaagcagtagaagcaacgcaagtttttaaattagacgaagaa
taa

DBGET integrated database retrieval system