KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1060Help
Entry
SPSINT_1060       CDS       T01396                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00260  Glycine, serine and threonine metabolism
ssd00750  Vitamin B6 metabolism
ssd01100  Metabolic pathways
ssd01110  Biosynthesis of secondary metabolites
ssd01120  Microbial metabolism in diverse environments
ssd01230  Biosynthesis of amino acids
Module
ssd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPSINT_1060
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPSINT_1060
Enzymes [BR:ssd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPSINT_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ADV05588
Position
1120253..1121317
Genome map
AA seq 354 aa AA seqDB search
MKLWKGLVEEYKAFLPVDENTPTVTLNEGHTPLIYCDTMSEMLGIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKMVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEVAEDGEIELVNSVNPYRIEGQKTSAFEIVEQLADQAP
DILAIPVGNAGNITAYWKGFKTYEEKYQTGLPHMFGFQAAGAAPIVNNQVVKNPETIATA
IRIGNPASWKQAVQAIEESDGLIEAVTDEEILEAYQLMTSKEGIFSEPASNASIAGLIKL
HRQGKLPQGKKVVAVLTGNGLKDPDTAIGLLENPIQALPNHKESIVQYIKDALK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatggaaaggtcttgttgaagaatacaaagcatttctaccagtagatgaaaac
acaccaacagtgacgttaaatgaagggcatacgccactcatttattgtgacacgatgtca
gagatgttaggcattgaactgtatgttaaatatgaaggcgctaatccaactggttcattc
aaagatcgaggcatggtcatggcagtcacaaaagcgaaagagcaaggcaagaaaatggtg
atctgtgcctcgacagggaatacatcggcttctgctgcggcatatgcggcgcgtgcaggt
ttaaaagctatcgtcgtcattcctgaaggtaagattgctttaggaaagttgtcgcaagct
gttatgtatggtgctgaaatcgtctctattgaaggaaactttgacgaagcgttagaaatc
gttaaagaagttgctgaagatggagaaatcgaattagtcaactcagtcaacccgtatcgt
attgaaggtcaaaaaacgagtgcttttgaaattgttgagcagttagctgaccaagcacca
gatattttagctattccagtaggtaacgccggaaatattactgcatattggaaaggtttt
aaaacgtatgaagaaaaatatcaaacaggcttaccacatatgtttggattccaagcggcg
ggtgctgcacctatcgttaacaatcaagtcgttaagaaccctgaaacaatagctacagcg
attcgtatcggtaatcctgcaagttggaagcaagcagttcaagcgattgaagaatctgac
ggtttaattgaagcagtcacagatgaagaaattttagaagcgtatcaactgatgacttct
aaagagggtatttttagcgaacctgcaagtaacgcatcgatagccggacttattaaatta
catcgccaaggaaaattgcctcaaggtaaaaaagtggttgcagttttaactggaaatggt
ttgaaagatccggatacggcgattggtttattagaaaatcctattcaagcattaccaaat
cataaagaaagtatcgttcaatacattaaggacgcgttaaaatga

DBGET integrated database retrieval system