KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1125Help
Entry
SPSINT_1125       CDS       T01396                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00020  Citrate cycle (TCA cycle)
ssd00310  Lysine degradation
ssd01100  Metabolic pathways
ssd01110  Biosynthesis of secondary metabolites
ssd01120  Microbial metabolism in diverse environments
ssd01130  Biosynthesis of antibiotics
ssd01200  Carbon metabolism
Module
ssd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSINT_1125
  Amino acid metabolism
   00310 Lysine degradation
    SPSINT_1125
Enzymes [BR:ssd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SPSINT_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 LAP1C Macoilin
Motif
Other DBs
NCBI-ProteinID: ADV05653
Position
complement(1195292..1196569)
Genome map
AA seq 425 aa AA seqDB search
MAEVKVPELAESITEGTIAEWLKQVGDTVEKGEAILELETDKVNVEVVSEEEGTIQELLA
EEGDTVEVGQAIAIVGEGGAATSSSDDSKTDSKDASNKSEQKASDKQEQKEEKSSSDKES
QSSPSNERINATPSARRAAREKGISLSEVSGKANDVVRKEDVERGSQQKSTGAAQSKEKE
AATPQAPKTPSKPVIREKMSRRKQTAAKKLLEVSNNTAMLTTFNEVDMTNVMALRKRKKD
KFMEDHDGTKLGFMSFFTKAAVAALKRYPEVNAEIDGDYMVTKQYYDIGIAVSTPGGLLV
PNVRDCDKKNFAEIEQEIANLASKARDNKLTLDDMMNGSFTITNGGIFGSMMSTPIINGS
QAAILGMHSIITRPVAIDQDTIENRPMMYIALSYDHRIIDGKEAVSFLKMIKELIENPED
LLLES
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtaaaagttccagaattagcagaatcgattacagaaggtaccattgcagaa
tggttaaaacaagtaggtgacactgttgaaaaaggtgaagccatccttgaattagaaaca
gacaaagtgaatgtcgaagtcgtttctgaagaagaaggtacaattcaagagttacttgct
gaagaaggcgacacagtagaagtcggccaagccattgcaatagtgggtgaaggtggcgct
gctacatcttcaagtgatgattcaaaaactgactcaaaagacgcgtcaaataaatcagaa
caaaaagcgtcagacaaacaagagcagaaagaagaaaaatcatcttctgacaaagaaagc
caaagcagtccttcaaacgaacgcattaatgcaacaccttcagcacgtcgcgcggcacgt
gaaaaaggcattagcttaagcgaagtgagtggcaaagcaaatgatgtcgttcgtaaagaa
gatgttgaacgcggctcacaacaaaaatcaacaggtgctgctcaatctaaagaaaaagaa
gctgctacaccacaagcacctaaaacaccatcaaaaccagtaattcgtgaaaaaatgagt
cgtagaaaacaaactgcagctaaaaaattattagaagtaagcaataacactgcaatgtta
acgacattcaatgaagtagacatgacgaacgtgatggcgctccgaaaacgtaaaaaagac
aaatttatggaagatcatgacggcacgaaacttggcttcatgtcattcttcacaaaagca
gcggttgccgcattgaagcgttaccctgaagtgaacgctgaaatcgatggcgactacatg
gttacaaaacaatactacgatatcggtattgccgtgtctacaccaggcggtttactcgta
ccaaacgttagagattgcgataagaagaactttgctgaaattgagcaagaaattgccaac
ttagcgtcaaaagcacgtgataacaaattgacactggatgacatgatgaacggctcattc
acaattacaaatggtggtattttcggttcaatgatgtcaacaccgattatcaatggtagt
caagctgcaattttaggtatgcactctattattacgagaccggttgcgattgatcaagat
acgattgaaaaccgcccaatgatgtacatcgcattaagttatgaccatagaattatcgac
ggaaaagaagccgtaagtttcttgaagatgattaaagagttaattgaaaaccctgaagat
ttattattagagtcttaa

DBGET integrated database retrieval system