KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1125Help
Entry
SPSINT_1125       CDS       T01396                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ssd01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ssd00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ssd00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1195292..1196569)
Genome map
AA seq 425 aa AA seqDB search
MAEVKVPELAESITEGTIAEWLKQVGDTVEKGEAILELETDKVNVEVVSEEEGTIQELLA
EEGDTVEVGQAIAIVGEGGAATSSSDDSKTDSKDASNKSEQKASDKQEQKEEKSSSDKES
QSSPSNERINATPSARRAAREKGISLSEVSGKANDVVRKEDVERGSQQKSTGAAQSKEKE
AATPQAPKTPSKPVIREKMSRRKQTAAKKLLEVSNNTAMLTTFNEVDMTNVMALRKRKKD
KFMEDHDGTKLGFMSFFTKAAVAALKRYPEVNAEIDGDYMVTKQYYDIGIAVSTPGGLLV
PNVRDCDKKNFAEIEQEIANLASKARDNKLTLDDMMNGSFTITNGGIFGSMMSTPIINGS
QAAILGMHSIITRPVAIDQDTIENRPMMYIALSYDHRIIDGKEAVSFLKMIKELIENPED
LLLES
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtaaaagttccagaattagcagaatcgattacagaaggtaccattgcagaa
tggttaaaacaagtaggtgacactgttgaaaaaggtgaagccatccttgaattagaaaca
gacaaagtgaatgtcgaagtcgtttctgaagaagaaggtacaattcaagagttacttgct
gaagaaggcgacacagtagaagtcggccaagccattgcaatagtgggtgaaggtggcgct
gctacatcttcaagtgatgattcaaaaactgactcaaaagacgcgtcaaataaatcagaa
caaaaagcgtcagacaaacaagagcagaaagaagaaaaatcatcttctgacaaagaaagc
caaagcagtccttcaaacgaacgcattaatgcaacaccttcagcacgtcgcgcggcacgt
gaaaaaggcattagcttaagcgaagtgagtggcaaagcaaatgatgtcgttcgtaaagaa
gatgttgaacgcggctcacaacaaaaatcaacaggtgctgctcaatctaaagaaaaagaa
gctgctacaccacaagcacctaaaacaccatcaaaaccagtaattcgtgaaaaaatgagt
cgtagaaaacaaactgcagctaaaaaattattagaagtaagcaataacactgcaatgtta
acgacattcaatgaagtagacatgacgaacgtgatggcgctccgaaaacgtaaaaaagac
aaatttatggaagatcatgacggcacgaaacttggcttcatgtcattcttcacaaaagca
gcggttgccgcattgaagcgttaccctgaagtgaacgctgaaatcgatggcgactacatg
gttacaaaacaatactacgatatcggtattgccgtgtctacaccaggcggtttactcgta
ccaaacgttagagattgcgataagaagaactttgctgaaattgagcaagaaattgccaac
ttagcgtcaaaagcacgtgataacaaattgacactggatgacatgatgaacggctcattc
acaattacaaatggtggtattttcggttcaatgatgtcaacaccgattatcaatggtagt
caagctgcaattttaggtatgcactctattattacgagaccggttgcgattgatcaagat
acgattgaaaaccgcccaatgatgtacatcgcattaagttatgaccatagaattatcgac
ggaaaagaagccgtaagtttcttgaagatgattaaagagttaattgaaaaccctgaagat
ttattattagagtcttaa

DBGET integrated database retrieval system