KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1125Help
Entry
SPSINT_1125       CDS       T01396                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPSINT_1125
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSINT_1125
  Amino acid metabolism
   00310 Lysine degradation
    SPSINT_1125
Enzymes [BR:ssd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SPSINT_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1195292..1196569)
Genome map
AA seq 425 aa AA seqDB search
MAEVKVPELAESITEGTIAEWLKQVGDTVEKGEAILELETDKVNVEVVSEEEGTIQELLA
EEGDTVEVGQAIAIVGEGGAATSSSDDSKTDSKDASNKSEQKASDKQEQKEEKSSSDKES
QSSPSNERINATPSARRAAREKGISLSEVSGKANDVVRKEDVERGSQQKSTGAAQSKEKE
AATPQAPKTPSKPVIREKMSRRKQTAAKKLLEVSNNTAMLTTFNEVDMTNVMALRKRKKD
KFMEDHDGTKLGFMSFFTKAAVAALKRYPEVNAEIDGDYMVTKQYYDIGIAVSTPGGLLV
PNVRDCDKKNFAEIEQEIANLASKARDNKLTLDDMMNGSFTITNGGIFGSMMSTPIINGS
QAAILGMHSIITRPVAIDQDTIENRPMMYIALSYDHRIIDGKEAVSFLKMIKELIENPED
LLLES
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtaaaagttccagaattagcagaatcgattacagaaggtaccattgcagaa
tggttaaaacaagtaggtgacactgttgaaaaaggtgaagccatccttgaattagaaaca
gacaaagtgaatgtcgaagtcgtttctgaagaagaaggtacaattcaagagttacttgct
gaagaaggcgacacagtagaagtcggccaagccattgcaatagtgggtgaaggtggcgct
gctacatcttcaagtgatgattcaaaaactgactcaaaagacgcgtcaaataaatcagaa
caaaaagcgtcagacaaacaagagcagaaagaagaaaaatcatcttctgacaaagaaagc
caaagcagtccttcaaacgaacgcattaatgcaacaccttcagcacgtcgcgcggcacgt
gaaaaaggcattagcttaagcgaagtgagtggcaaagcaaatgatgtcgttcgtaaagaa
gatgttgaacgcggctcacaacaaaaatcaacaggtgctgctcaatctaaagaaaaagaa
gctgctacaccacaagcacctaaaacaccatcaaaaccagtaattcgtgaaaaaatgagt
cgtagaaaacaaactgcagctaaaaaattattagaagtaagcaataacactgcaatgtta
acgacattcaatgaagtagacatgacgaacgtgatggcgctccgaaaacgtaaaaaagac
aaatttatggaagatcatgacggcacgaaacttggcttcatgtcattcttcacaaaagca
gcggttgccgcattgaagcgttaccctgaagtgaacgctgaaatcgatggcgactacatg
gttacaaaacaatactacgatatcggtattgccgtgtctacaccaggcggtttactcgta
ccaaacgttagagattgcgataagaagaactttgctgaaattgagcaagaaattgccaac
ttagcgtcaaaagcacgtgataacaaattgacactggatgacatgatgaacggctcattc
acaattacaaatggtggtattttcggttcaatgatgtcaacaccgattatcaatggtagt
caagctgcaattttaggtatgcactctattattacgagaccggttgcgattgatcaagat
acgattgaaaaccgcccaatgatgtacatcgcattaagttatgaccatagaattatcgac
ggaaaagaagccgtaagtttcttgaagatgattaaagagttaattgaaaaccctgaagat
ttattattagagtcttaa

DBGET integrated database retrieval system