KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1210Help
Entry
SPSINT_1210       CDS       T01396                                 

Definition
branched-chain alpha-keto acid dehydrogenase, E1 component subunit beta (EC:1.2.4.4)
Orthology
K00167  
2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC:1.2.4.4]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ssd00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1280369..1281352)
Genome map
AA seq 327 aa AA seqDB search
MAKISYLEAIRQALDVALEKDAQTMILGEDVGKKGGVFGVTAGLQEKYGVYRVLDTPLAE
SNIVGSAIGAAMMGKRPIAEIQFAEYILPATNQIMSEAAKMRYRSNNDWQAPLTIRAPFG
GGIHGALYHSQSIESVFTSTPGLTVVIPSTPYDAKGLLLASIASNDPVLFFEHKKAYRLL
KEEVPEGYYTVPLGKADVKRQGSDITVFSYGLAVNYCLQAADLLKGEAIDVEVVDLRTVY
PLDQQTIIECAKKTGKCLLVTEDNKEGSVMSEVAAIIAENCLFDLDAPVMRLAGPDVPAM
PFSPPLEDEFMINPDKIKNKMRELAQF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatttcatatcttgaagctattagacaagcacttgatgtcgcgctagaaaaa
gatgcgcaaacgatgattcttggtgaagatgtaggtaaaaaaggtggcgtttttggggtg
acagctggattacaagaaaaatatggcgtttatcgtgtattagatacaccacttgctgaa
tccaacattgtcggttctgctattggtgcagcgatgatggggaaacgtcctattgctgaa
atacaatttgcggaatatattttaccggcgactaaccaaattatgagtgaagctgctaaa
atgcgctatcgttctaacaatgattggcaggcaccattaacgattcgcgcaccattcggc
ggtggtattcatggcgcactttatcattcacaaagtatcgaaagtgtatttacgtctact
ccaggcttaactgttgtcattccatccacaccttatgatgcaaaaggcttacttttagcg
tcaattgcatcaaatgaccctgtgcttttctttgagcataaaaaggcatatcgcttacta
aaagaagaagtgccagaaggatattacactgtgccgcttggtaaagctgatgtcaaacga
caaggtagcgatatcacagtattttcatatggtctagcagtgaactattgtcttcaagca
gcagatttattaaaaggtgaagctatcgacgtcgaagtggttgatttgcgtactgtctat
ccgctcgatcaacaaacgattattgaatgcgcgaaaaagacaggtaaatgtttgttagtc
acagaagacaataaagaaggtagcgtcatgtcagaagttgccgcgattattgctgaaaat
tgtttatttgatttagatgcacccgtaatgcgattggcgggtccagatgtgccagcgatg
ccattttcaccaccgttagaagatgaatttatgattaacccggataaaattaaaaataaa
atgcgtgaattagcacaattttaa

DBGET integrated database retrieval system