KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1384Help
Entry
SPSINT_1384       CDS       T01396                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPSINT_1384
Enzymes [BR:ssd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SPSINT_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1428076..1430475)
Genome map
AA seq 799 aa AA seqDB search
MENPTLFDHTFIKGTVEMILFQNTDNHYTVLKVEIEETNGDFDDMATVVGYFPNMVEDES
YTFKGQIVQHARYGQQLKAETFQKEIPHTKDAVIAYLSSELFKGIGKKTAESIVNTLGEN
AIHDILKDESVIEQVPKLSKAKQQQIVEQIYANQESEQVMIRLNELGFGSKLAMDIYKFY
KSDTLTVLDQNPYQLVYDIKGVGFNKADQLAQQLGIHPEHPDRLKAGLLYLVEDTCIKQG
HTYLPQEALINETIQLLSQGKDSSVDYDTMTQILAELVEEKRLVNQEEMVAIPSLYYSEI
KSTQNLYKIFANREHLTTFDASDIQLHIGEIEEVNEVHYAPSQKEALEYAIQHKVMLLTG
GPGTGKTTVIKGIVQLYAEIHGISLDYDDYSDEDDYPVVLAAPTGRASKRLHEATGLEAM
TIHRLIGWNQDTKPQDKLDNEIHAKLIIIDEMSMVDTWLFHQFMDAVPIDAQVVLVGDED
QLPSVGPGQVFKDLIDANVLPRINLTEVYRQQDGSSIIDLAHRMKLGEKVDITQRFHDRS
FIPCQTDQIPQVVEKVVNNAVQKGYTMADIQVLAPMYRGNAGIKKLNQILQGILNPLSDE
SQREIEFGDVLFRKGDKVLQLINRPNDNVFNGDIGVIVGIFWAKENALNKDVVVVDYDGN
EITYLRSDLTELTHAYCTSIHKAQGSEFPIVIMPIVKQYFRMLQKPILYTGLTRAKQSLV
FLGDADAFNIGLATAGQTRLTQLQTFLMQYFTPEDTDDKTDTDTASAEFILTEATMFKIH
PMINMGEVTPYDFLEIDKV
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatccaacactgtttgaccatacatttattaaaggcaccgtagagatgattttg
tttcagaatacggacaatcattacacagtgcttaaagttgaaatagaagaaacaaatggt
gactttgatgatatggcaacagtggttggatattttccgaatatggtagaagatgagtcg
tacacttttaaaggccaaatcgtgcaacatgcaagatatggtcagcaattaaaagctgag
acgtttcaaaaagaaattcctcataccaaagatgctgttattgcatatttatctagtgaa
ttgtttaaagggattggtaaaaaaacagcagaatccattgtcaatacattaggtgaaaat
gcgattcatgacattttgaaagatgaatctgtcatcgaacaagtgcctaaactgtctaaa
gcgaaacaacaacaaattgtcgagcagatttatgccaaccaagaaagtgaacaagtgatg
attcgattgaacgaacttggttttggttcaaagcttgcgatggacatttacaagttttat
aaaagtgatacattaacggtactcgaccaaaatccgtatcaacttgtttatgacattaaa
ggggttggttttaacaaagcggaccaactggcacaacagctcggtattcatccagagcac
cccgaccgtttaaaagccggcttactttatttagttgaagatacgtgtattaaacaaggt
catacgtacctcccacaagaagcgttaatcaatgaaacgattcaactgctgtctcagggc
aaagattcaagtgtcgactatgacaccatgacgcaaattttagctgaattagttgaagaa
aaacgactagtgaatcaagaggaaatggtggccatcccaagtctttattattcggaaatt
aaaagcacacaaaatttatataaaatatttgccaatcgagagcatttaactacatttgat
gcttcagatattcaattacatattggggaaattgaagaggtcaatgaagtacattatgcc
ccttctcaaaaagaggctttagaatatgcgattcaacataaagtcatgcttctcacgggt
ggaccaggtacagggaaaacaactgtcattaaaggaattgtccagttatatgcagaaatt
cacggcatctcattagattacgatgactattcagatgaagatgattatccggtcgtatta
gctgcaccaaccggaagagcgtctaaacgtttacatgaagcgacagggttagaagcaatg
acgattcaccgcttaattggttggaatcaagatacgaagccgcaagacaaattagacaat
gaaattcatgcgaaattgattattattgatgaaatgtctatggtcgacacttggctattc
catcaatttatggatgcagtccctatagatgcccaagtcgtattagtcggtgatgaagac
cagcttccatcagttggccctggacaagtttttaaagatctcattgatgcaaatgtatta
ccgcgcatcaatttaactgaagtttatcgccaacaggacggctccagtattattgattta
gcgcatcgtatgaaactcggtgaaaaagttgatattacccaacgttttcacgatcgttcg
tttattccatgtcaaaccgatcaaattccacaagtcgtagaaaaagtcgtcaacaatgcc
gtgcaaaaagggtatacaatggcagatattcaagtgctcgcgccgatgtatcgtggtaat
gcagggattaaaaagctcaatcaaattttacaaggcattttgaaccctttgtcagacgaa
tcgcaacgtgagattgaatttggtgatgttctatttcgtaaaggcgacaaagtattgcaa
ctgattaatcgtccaaacgataatgtgtttaatggtgatattggtgttattgtcggtatt
ttttgggcaaaggaaaatgctttaaataaagatgtcgtggtcgttgattatgatgggaac
gaaattacttatttacgctctgatttgacggaattgacacatgcatattgtacttcgatt
cataaagcgcaaggttcagagtttccaattgtcatcatgccgattgttaagcagtatttt
agaatgttacaaaaaccgattttatatactggattaacgcgtgccaaacaatcgctcgtt
tttcttggtgatgcagatgcttttaatatcgggttagcgactgcgggtcaaacgcgatta
acacaattacaaacgttcttaatgcaatattttactccggaagatactgatgataaaaca
gatactgatacagcttcggctgagtttattttaactgaagcgactatgtttaaaatccat
ccgatgattaatatgggtgaagtgacaccttatgactttttagaaattgacaaagtttaa

DBGET integrated database retrieval system