KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1424Help
Entry
SPSINT_1424       CDS       T01396                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPSINT_1424
Enzymes [BR:ssd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SPSINT_1424
Exosome [BR:ssd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPSINT_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1470827..1471804)
Genome map
AA seq 325 aa AA seqDB search
MQFDRHRRLRSSKVMRDMVRETHVRKEDLIYPIFVVEKDDVKAEIKSLPGVYQISLNLLH
EELKAAYDLGIRAIMFFGIPNEKDACGTGAFIEDGIIQKATRLAKSMYNDLLILADTCLC
EYTDHGHCGVIDTHTHDVDNDKTLPLLVQTAVSQVKAGADIIAPSNMMDGFVAAIRQGLD
EAGYYHIPIMSYGIKYASSFFGPFRDAAESAPSFGDRKTYQMDPANRLEALRELESDLNE
GADMMIVKPALSYLDIIRDVRNNSNVPIIAYNVSGEYSMTKAAALNGWIDEEKVVMEQMI
SMKRAGADMIITYFAKDICQYLDQQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgatagacatagacgattacgttcatcaaaagtgatgcgtgatatggtaaga
gaaacacatgtgagaaaagaagatttgatttatcctatttttgttgtagagaaagatgat
gtcaaagcagaaatcaaatcattaccaggcgtatatcaaatcagcttaaacctactacat
gaagaattgaaagcggcatatgatttagggattcgtgccattatgttctttggaattccg
aatgaaaaagatgcatgtgggaccggcgcatttattgaagatggcatcattcaaaaagca
acacgtttggcaaagtccatgtataatgatttattaattcttgccgatacatgtttatgt
gaatatacggatcatggtcattgtggtgtgattgacacacatacacatgatgtcgataat
gataaaacattgcctttacttgttcaaacagctgtttctcaagtgaaggcgggcgcagat
attattgctcctagtaatatgatggatggatttgtggcagcaattcgccaaggtttagat
gaagcaggatactaccatattccaattatgagttacgggattaaatatgcgtcaagcttc
ttcggcccattccgtgatgcagcggaatccgcaccatcatttggtgatagaaaaacgtat
caaatggacccagcgaaccgtcttgaagcgttacgagagttagaatctgatcttaacgaa
ggggcagatatgatgattgtcaagccagcgttaagttatcttgatattattcgtgatgta
cgtaacaatagcaacgtaccgattattgcttataatgtgagtggtgagtacagcatgaca
aaagcagcagcattaaatggttggatagatgaagaaaaagttgtgatggagcaaatgatt
tctatgaaacgcgcaggagcagatatgatcatcacttactttgcgaaagacatttgtcaa
tatttagatcaacaataa

DBGET integrated database retrieval system