KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1425Help
Entry
SPSINT_1425       CDS       T01396                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ssd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1471804..1472481)
Genome map
AA seq 225 aa AA seqDB search
MKPIIVMTQTKRYDDQRAEIVHLPFVTTEPLPFDQSVLGRHYDWLVFTSQNAVTHFQPYL
KLLNFNRLAVIGEKTKAFCESQGLRVDFFPADYSQEGFLDAFPTQQGQHILIPSSQRARP
LLQEVLQVRGFNVEKIDLYTSCFLLENVKEAKARIETGQVDALTFASASAVKAFFHDDTS
LNFDSYYAIGQQTARQIQDYGYSCSIADIQTLESMVTKILEERVQ
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctattatagtgatgacccaaaccaagcgttatgatgatcagcgcgctgaaatc
gttcatcttccatttgtgacgactgaaccacttccttttgatcaatcagtgctaggtcgt
cactatgattggcttgtttttacatctcaaaatgccgttacgcattttcaaccttattta
aagttgttaaattttaatagattagcggtcattggcgagaaaacgaaagcattttgtgaa
tcacaagggttgcgagtggatttcttcccagcagattactcacaagaaggatttctcgat
gcattccccacacaacaagggcagcatattttgattccatccagtcaacgcgcacggcca
ttactgcaagaagtgttgcaagtacgtggtttcaatgttgaaaaaattgatttgtatact
tcatgttttttattggaaaatgtgaaagaagccaaagcacgtatcgaaacaggtcaagtg
gatgcattgacgtttgcgagtgcttctgctgtcaaggcgttttttcacgatgatacgtct
ttaaatttcgactcgtattatgcaattggtcaacaaacagcacgacagattcaagattac
ggctattcatgttctattgctgacattcaaactttagaatcaatggtgacaaaaatttta
gaagagagggttcaataa

DBGET integrated database retrieval system