KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1455Help
Entry
SPSINT_1455       CDS       T01396                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPSINT_1455
   01230 Biosynthesis of amino acids
    SPSINT_1455
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSINT_1455
   00030 Pentose phosphate pathway
    SPSINT_1455
   00051 Fructose and mannose metabolism
    SPSINT_1455
   00052 Galactose metabolism
    SPSINT_1455
  Energy metabolism
   00680 Methane metabolism
    SPSINT_1455
Enzymes [BR:ssd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPSINT_1455
Protein phosphatases and associated proteins [BR:ssd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPSINT_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1504952..1505920)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAIRAVVRKALYHNIEVYGVYQGYQGLINDDIRKLELGSVGDI
IQRGGTFLYSARCPEFKEKEVRQKGIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIESVDKIRDTASSHARTFIIEVMGRDCGDLAL
WSGLAVGAETIILPETETDIKDIAEKIQHGIDRGKKHSIIIVAEGCMTGDMCASELTKYI
NVDARVSVLGHIQRGGSPTGADRVLASRLGGYAVELLLNGETAKGVGIKDNRLVATNFDE
IFNTSERQINQRMLGLTEELSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcagttttaacaagtggcggagattctccggggatgaatgcagcaatt
cgagcagttgtaagaaaagcgctttatcacaatattgaagtctatggtgtgtatcaaggt
tatcaaggtttaatcaatgacgacattcgcaaactcgagttgggttcagttggcgatatt
attcaacgtgggggtactttcttatattcagcacgttgcccagaatttaaagaaaaagaa
gtacgccaaaaagggattgaaaatcttagaaagcgtgggattgaaggtttagtcgttatt
ggtggcgatggaagttaccgtggtgcacaacgtattagtgaagagtgtaaagaaattcaa
acgattggtattccaggtacaattgataacgatattaatggtactgattttacaatcggt
tttgatacagcgttaaatacaattattgaatctgtggacaaaatccgagatactgcttca
agccacgcacgcacttttatcattgaagttatgggccgtgactgtggagatttagcatta
tggtcaggtttagctgtaggcgctgaaacaatcattttacccgaaacagagacagacatt
aaagatatcgcagaaaaaattcaacatggtattgatagaggtaaaaagcattctattatc
attgttgcagaaggttgtatgacgggtgatatgtgcgcatcagaattaacaaaatatatt
aatgttgatgcacgtgtatctgtgctcggccatattcaacgtggcggtagcccaacaggt
gcagaccgagtacttgcatcacgtttagggggctatgctgttgagcttttacttaacggc
gaaacggcgaaaggtgtcggcattaaagacaaccgattagttgcgactaattttgatgaa
atttttaacacttcagaacgtcaaattaaccaacgtatgttaggtttaactgaagaatta
tctatataa

DBGET integrated database retrieval system