KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1565Help
Entry
SPSINT_1565       CDS       T01396                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPSINT_1565
   01230 Biosynthesis of amino acids
    SPSINT_1565
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSINT_1565
  Energy metabolism
   00680 Methane metabolism
    SPSINT_1565
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPSINT_1565
Enzymes [BR:ssd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPSINT_1565
Exosome [BR:ssd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPSINT_1565
  Exosomal proteins of melanoma cells
   SPSINT_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1618961..1619509)
Genome map
AA seq 182 aa AA seqDB search
MVKTIYFVRHATREHTVKSDTAPLSEKGRREAENLVKWFEGKHVDAIYASPYARTLETVV
PLARVNNINIQVEDGLRERVIGEWVDDFDTYAAEQWMNFDYRLLGGESLKQVQKRIVSSF
QDILSQEKGETIVISGHGTSLAVLFHTLTDGTFAYEQFKQMTMPDVYTYDVDTKVLKRTY
LN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaacgatttattttgtaagacatgcgacgagggagcatacggtgaagtctgat
acggcgccattatcagaaaaagggcgacgagaggcagaaaaccttgtgaagtggtttgag
gggaaacatgtcgatgccatttatgcgagtccatatgcgcgtacgcttgaaactgtagta
ccacttgcacgtgtgaacaatataaatattcaagtagaggatggtttaagagaacgcgtc
atcggtgaatgggtggatgattttgatacatacgctgctgaacaatggatgaattttgat
tatcgcttacttggaggggagtcgttgaaacaagtgcagaaacgtatcgtatcgagtttt
caggacattttgtcacaagagaaaggtgagaccattgtgatcagtggtcatggtacgtca
ctcgctgtgctctttcatacgttgacagatggtacatttgcttatgaacagttcaaacag
atgacgatgcctgatgtttatacttacgacgttgatacaaaagttttaaaacgcacatat
ttgaactga

DBGET integrated database retrieval system