KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1574Help
Entry
SPSINT_1574       CDS       T01396                                 

Definition
protoporphyrinogen IX oxidase, aerobic (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ssd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1627451..1628854)
Genome map
AA seq 467 aa AA seqDB search
MTNVAIIGAGITGLSSAYFIKQKYPHVNVTIYEATDRPGGKIKTVHHDGYTIELGPESYL
GRKTIMTEVAKAVGMTDDDIVTNETGQSYIFANDTLYPIPGGAILGVPTDIKPFMSTKLI
SMKGKLRALKDLTIKPIEMENEDMSVGEFFRTRLGDEVLENLIEPLLSGIYGTDIDVLSL
MSTFPNFKALEEEHGSIIKGMQHVKKKRQQQAQHNQQGPQGQFKQFRHGLNDFVNKLEQW
LKAHDVTFQYETPVHDLIGTQKGYYVELNDESRSFYDGVIVATPHQVFREWFSTDPMFDY
FSKLEASSVATIVFAFDEANIENTSDGTGFVVARTSATDITACTWTTKKWPHTTPEGKVL
IRAYIGKQGDNIVNEKTDEELVAIAKNDLQQMMTFHGEPDFTIVNKMPYASPQYHVGHIA
RIKAIQQHICDNYQHLQITGAPFEAVGLPDCIRQAETAVKQLLSRIG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgtagcaatcattggtgcgggtattacaggtttatcaagtgcatactttatt
aaacaaaagtatccgcatgtgaatgtaacgatttatgaagcaacagatcgacctggtggc
aaaattaaaacggtacaccatgatggctatacgattgaacttggccccgaatcttattta
ggtcgcaaaacgattatgactgaagtggctaaagcagtagggatgacagatgatgatatc
gtgacaaatgaaacgggtcaatcgtatatttttgccaatgatacattatatccgattcca
ggcggcgcaattttaggtgtaccgactgacattaaaccatttatgtcaacaaaactcatc
tcaatgaaagggaaattgcgcgcattaaaagatttgacgattaaaccgattgagatggaa
aatgaagacatgtcggtaggtgaattttttaggacacgtctcggtgacgaagtgcttgaa
aatttaattgaaccgttactgagtggtatttatggtacagacattgatgtgttgagttta
atgagtacgtttccgaacttcaaagcattagaggaagagcacggtagtatcattaaaggg
atgcaacatgtcaaaaaaaagcgtcaacaacaagcacaacataatcaacaaggcccacaa
ggacaatttaagcaattcagacatggtttgaatgactttgtgaacaaacttgaacaatgg
cttaaagcgcatgatgtgacatttcagtatgaaacgcccgtgcatgatttaattggcaca
caaaaggggtattacgttgagttaaatgacgaatcgcgttcattttatgatggtgtcatt
gtcgcaacgccacatcaagtgtttagagagtggtttagcactgatccgatgtttgattat
ttttcgaaactagaagcatcatctgtcgctacgattgtctttgcatttgatgaagccaat
attgaaaatacgtctgatggtacaggatttgtggttgcgagaacgagtgcgacggatatt
actgcgtgtacgtggacaaccaaaaaatggccacatacgacaccagaaggcaaagtcctc
attcgtgcatatatcggcaaacaaggtgataacatcgttaatgaaaagacagatgaagaa
ctggtagcaatcgctaaaaatgacttacaacaaatgatgacatttcacggcgaacctgac
tttacaatcgtaaataaaatgccgtatgcgagtcctcaatatcacgtcggtcatattgct
cgaattaaagcgatacaacaacatatttgtgacaattatcaacatttacaaattacaggt
gcaccgtttgaagcggttggattgccagactgtattcgacaagcagaaacagcagttaaa
caattgttgtcacgaattggataa

DBGET integrated database retrieval system