KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_2219Help
Entry
SPSINT_2219       CDS       T01396                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPSINT_2219
  Amino acid metabolism
   00340 Histidine metabolism
    SPSINT_2219
Enzymes [BR:ssd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SPSINT_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2328146..2329405
Genome map
AA seq 419 aa AA seqDB search
MIVNSQTFLQQFETTETFNPEIHAQVTAICDRVRREGDLALHDYNQQFDGIKVEALEVPQ
ADVAAAYHNIDEDLRHALEYSFRRIRDYQTQIKYENQYATPELYEVYHPIERVGIYVPGG
KASYPSTVLMTATLAKVAGVKNISVVTPPQPNGVAPSVLAACHIAGVDHVYQVGGAQSIA
ALAYGTETIPKVDKIVGPGNQYVAYAKKAVYGEVGIDQIAGPSEIALIIDDTCNLEAVVY
DVFAQAEHDEMARTFVISTDLALLESLESRIQQTLNGAPRHDILKVSLKDNHSLIHATDF
EDSCHVMNTIAPEHASIQTAQPENYLPHIHYVGSLFLGGYAPEAIGDYIAGPSHVLPTQR
TARFQHGLSVNDFLTKHTVIHLSKATYEKTYRDAARIAQDEQLYHHQKSLEIRQRGDDA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgttaatagccaaacctttttacaacaattcgaaacaacagaaacattcaatcct
gaaattcatgcacaagtcactgccatttgtgaccgcgtgcgacgtgaaggagacctagca
ttacatgactataatcaacaatttgatggcatcaaggtggaggcgttggaagtgccacaa
gctgacgttgcagcagcgtaccacaatatagatgaagatttacgtcacgcacttgagtat
agtttccgaagaattcgagattatcaaacgcaaatcaaatacgaaaaccaatacgcgaca
cctgaactttatgaagtgtatcacccgattgaacgtgtcggtatatatgtgccaggcggt
aaagcgagctacccttccactgtattaatgacggccacactcgcgaaagtagccggtgtg
aaaaacatcagtgtcgtcacgccgcctcagccgaatggtgttgcaccgagtgtactcgca
gcatgtcatattgctggtgtggatcatgtgtatcaagtcggcggtgcacaaagtattgca
gcactcgcttatggtacggaaaccatcccgaaagtcgataaaattgtcggtccaggtaat
caatatgtcgcctatgcgaaaaaagcagtgtatggcgaagtcggtatcgatcaaattgcg
ggacccagtgaaattgcattgataattgatgatacatgcaacttagaagcagttgtctat
gatgtatttgctcaagcagaacatgatgaaatggcgcggacatttgtcatttcaacagat
ttggcattgctcgaaagtttagaaagccgtatccaacaaacacttaacggtgcaccacgc
catgacattttaaaagtcagtttgaaagataatcactctctcattcacgcgactgatttt
gaagacagttgtcatgtgatgaacactattgcaccagagcatgcatcaattcaaaccgcg
cagcctgaaaactatttgccacatattcactatgtcggcagcctattcttaggtggctat
gcgccggaagcgattggagactatattgcgggaccgagccacgttctaccaacacaacga
acagcccgctttcaacacggtttatcggtcaatgactttttaacgaaacatacggtgatt
cacttatcaaaagcaacctatgaaaaaacgtatcgagatgccgcacgtatcgctcaagat
gaacaactgtatcaccaccaaaaatcattagaaattagacaaagaggtgacgacgcatga

DBGET integrated database retrieval system