KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_2247Help
Entry
SPSINT_2247       CDS       T01396                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPSINT_2247
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPSINT_2247
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPSINT_2247
Enzymes [BR:ssd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPSINT_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2362225..2365221)
Genome map
AA seq 998 aa AA seqDB search
MEFNFHTNINIQHVNMLPRTAYKLPYTSIEEYQTHPGPHHMHRVTSLNGEWDFQYFASLD
HFRQRSSYAQKGIITVPSVWNLQGYDQLQYCNVQFPIPFDLPHVPDNTSCGYYEKIFTIK
NYQEGLDYHLTFEGVSGAHYIWVNGAFVGYAQISHALSQFDITERVTEGDNHIAVLVLKY
SDATYFEDQDMFRHSGIFRDVYIVARQRERLNDYQIHTAIGDSVGYIDVTVQDVAEGVTL
HYQLLNPDQRSITEGTLNEKMTRISVTEPRLWSAEHPDLYTLIIEANGEYFVQRVGIREV
KIAQQQLWMNGQAVKLRGVNYHDSHPQTGYTVTEEQLIKDLTLMKKANFNAIRTAHYPKS
PRFYELTDQYGFYVMSEADLETHGVVLLYGDENLDDFNLIMDDPRYEQAVVDRIDASIVP
FKNFSSIISWSMGNESGYGCNMERGLAHAKALDASRPLHYEGAHYAASHHDRSNLDMISR
MYPSPEEVETRYLTKPNLDKPFVLCEYAHAMGNSPGGLKAYHELMERYDSFIGAFVWEWC
DHAIQVGMKEGRPMYRYGGDFGEKVHDGHFCVDGIVSPQRTPHAGYYEFQQVHRPLVFIA
REGTRLTFKNKLDFTNIHDYVTLQIMVTTITGETATFTVDAPYIEPHAQGELDIASYVHL
DIKDLSTCTIQYILKADHPLLTPGERIGHDQVVFQRIESTHFVPETTEIPLYLNETETTI
QVKRGRWCYILDKHTANLQQVSHQQTMLLSEGSQLNIWRAPTDNDIQIQQGWRTAKYDTA
YPKVYHTHVQQQEDHVIITFDMSMVEDSRPRLVEGIVTWTISEDGTIHVAHQLKKDVRMP
SLPRLGVTFGLPDRFQALTYYGQGPYESYQDKQEASYLSVFNTTVRDQYEHPIFPQEVGA
HIDTTYVGLHDGSYTCAVWSETPLSMNAKPYSDAMLTGAHHDDELEETGVSYLHIDTAQS
GIGTNSCGPELPEQYRLLEEHYHFDFKLKFYEQTSITE
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaattttcatacgaatatcaacatacaacatgtgaacatgttaccccgaaca
gcatacaagctcccttacacaagtatagaggaatatcaaacgcatcctgggcctcaccac
atgcatcgtgtgacgtcactgaatggggaatgggattttcaatattttgcatcactcgat
cactttcgtcagcgttcatcatatgcgcaaaagggtatcatcacggtgcctagtgtttgg
aatttacaaggttatgaccaactacaatattgtaatgtgcagtttccgattccatttgat
ttaccccatgtgccagataatacatcgtgtggttattatgaaaagatttttacgattaaa
aattatcaagagggtttggattatcatttaacatttgaaggtgtgagtggtgcgcattat
atttgggtgaatggagcgtttgtcggttatgcacaaatttcgcacgcactttctcagttt
gatattactgaacgggtgacggaaggtgataaccatattgcagtgctcgtattgaaatat
tctgatgcgacgtattttgaagaccaagatatgttccgtcattcaggcatttttcgtgat
gtatatattgttgcgcgtcagcgtgaacggttgaatgattaccaaattcatacggcgatc
ggtgacagtgtcggttatatcgatgtcactgtacaagatgttgcagaaggtgtgacgctt
cattatcaattactgaatccggaccaacgtagcataactgaagggacgctgaatgagaag
atgacgcgcatctctgtgacggaaccgcgattatggagtgctgaacatcctgatttgtat
acgctgatcattgaagcgaatggtgaatatttcgtacaacgcgtcggtattcgagaagtg
aagattgcgcaacaacaactttggatgaatggacaagctgtgaaactgcgcggggtcaat
tatcacgatagccacccacaaacggggtatacggtgacggaagaacagctcatcaaagat
ttaacactcatgaaaaaagcgaatttcaatgcgattcgtacggcacattatccgaaaagt
cctcgcttttatgaattaaccgatcaatatggcttttatgtgatgagtgaagcggattta
gaaacacatggtgtggtgcttttgtatggcgatgaaaatttagatgacttcaacctaatc
atggatgatccccgctatgaacaagctgttgttgatcgtattgatgcatcgatagtcccg
tttaaaaattttagttcgattatttcgtggtcaatggggaatgaatctggctatggttgt
aatatggaacgtggtctcgcacatgcgaaagcgttggatgcatctcgcccactccattat
gaaggggcccattatgccgcgtcacatcatgatcgttcaaatttagatatgatttcacgc
atgtatccgtcacctgaagaagttgaaacgcgttatttaacgaaaccgaacttggataag
ccgtttgttttatgtgaatatgcacatgcgatggggaattctccaggtgggttaaaggcg
taccatgagttgatggaacgttatgatagctttattggtgctttcgtgtgggaatggtgt
gaccatgcgatacaagtagggatgaaagagggacgtccaatgtatcgttacggtggcgac
tttggtgaaaaggtgcatgacggccatttttgtgtagatggtattgtgagtcctcaacgc
accccacatgcaggttattacgaatttcaacaagtgcatcgtccgctcgttttcattgca
cgtgaaggcacgcgtttaacgtttaaaaacaaattggactttacgaatattcatgactat
gtaacacttcaaataatggtgacaacgattacaggtgagacagcaacatttacagtggat
gccccttatattgaaccacatgcgcaaggtgagttggatattgcgtcatatgttcatctt
gacataaaggacttgagcacatgtacgatccaatatattttaaaggcagatcatccttta
ttgactccgggagaacgtataggtcatgatcaagtcgtctttcagcgtatcgaaagtaca
cattttgtaccggagacaacggaaatcccattgtatttgaatgagacggaaacgactatt
caagtgaagcgcgggagatggtgctatatattggataagcatacagcaaacttacaacaa
gtgtctcatcaacagacaatgttactatcagaaggtagccagttgaacatttggcgtgcg
ccgacagacaatgatattcaaattcaacaaggttggcgtacagcgaagtatgatacagct
tatccgaaagtgtaccatacgcatgtgcaacaacaagaggaccatgtgattatcacattt
gatatgagcatggtggaagactcacgtccgcgtttagttgaagggatagtgacatggacg
atatccgaagacggtacgattcatgtggcacatcaattaaagaaagacgtgcgcatgccg
agcttaccaagattaggtgtaacattcggcttgccggaccgcttccaagcactgacgtat
tacggacaaggtccatacgaaagctatcaagataagcaagaagcgagttatttatctgtg
ttcaatacgactgttcgtgatcaatatgaacatcctattttccctcaagaggtcggcgcg
catatcgataccacttatgtagggctacatgatgggagctatacatgtgccgtttggtca
gagacgccactcagtatgaatgctaaaccatattccgatgcgatgttgaccggggcacat
catgatgatgaattagaagaaacaggcgtgagttatttgcatatagatacagcacagagc
ggtatcggcacgaatagttgtggaccggaattacccgagcagtaccgattactagaagaa
cattatcacttcgactttaagctcaaattttatgaacaaacttcaataacagaataa

DBGET integrated database retrieval system