KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_2251Help
Entry
SPSINT_2251       CDS       T01396                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPSINT_2251
   00052 Galactose metabolism
    SPSINT_2251
   00500 Starch and sucrose metabolism
    SPSINT_2251
   00520 Amino sugar and nucleotide sugar metabolism
    SPSINT_2251
Enzymes [BR:ssd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPSINT_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2369990..2370853)
Genome map
AA seq 287 aa AA seqDB search
MKKITKAVIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAVRAGIEDIIIVTGKH
KRAIEDHFDNQIELEMNLAEKGKDDLLEKVQHATQLANMFYVRQKEQKGLGHAIWTAKQF
IGDEPFAVLLGDDIVESETPAIQQLMEEYERTGKSVIGVQEVPERETHRYGIVDPKNQQE
RLYEVTQFVEKPVFGTAPSNLAIMGRYVLTPDIFDYLENQEEGAGGEIQLTDAIERLNQS
QQVFAYRFEGERFDVGEKVGFVKTTIQFALRDAEMADEIRVFLKEVQ
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataacgaaagctgtgattcccgcagcaggtttaggtacacgttttttacct
gcgacgaaagctatgccgaaagagatgttgccgattttagataagccgacgattcaatat
attgtggaagaagcggtacgtgcgggcattgaagatattattatcgttactggtaaacat
aaacgtgcgattgaagatcattttgacaatcaaatcgagctcgaaatgaacttggctgaa
aaaggcaaggatgatttgttagaaaaggttcaacatgcgacacaattggcgaatatgttt
tacgtccgtcaaaaagagcaaaaagggttagggcatgcgatttggacggcgaaacaattt
attggtgacgagcctttcgcggtattgctaggtgatgatattgtcgaatcagagacgcca
gcgattcaacagctgatggaagaatatgagcgcacaggtaaatccgtcatcggtgtgcaa
gaagtgcctgaacgtgaaacgcatcgttacgggattgttgacccgaaaaatcaacaagaa
cgtttgtatgaagtgacgcaatttgttgaaaagccagtctttggtacagcaccatctaat
ttggcgattatgggtcgctatgtattgacaccggatattttcgattatttggaaaatcaa
gaagagggagctggcggtgaaattcaattaaccgatgcgattgagcgtttaaatcagtcg
caacaagtatttgcctaccgtttcgaaggtgagcgatttgatgtgggtgaaaaagtcggt
ttcgtcaaaacaacgattcaatttgctttacgtgatgcagaaatggctgacgaaattcgt
gtatttttaaaagaagtgcaatga

DBGET integrated database retrieval system