KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_2403Help
Entry
SPSINT_2403       CDS       T01396                                 

Definition
acetylornithine deacetylase (EC:3.5.1.16)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssd01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ssd00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2551445..2552611)
Genome map
AA seq 388 aa AA seqDB search
MSVLSSDEKIQILRDIIEIQSVNDYEVEVAQYLKNLFDKYQINAQILKLENSETRANLVA
EIGSGHPVLGVSGHMDVVNVGDITTWQYEPFQLTEDEDGRLHGRGTADMKAGLAALVISM
IEIKEAGLLKKGTIRLLATAGEEIASEGAAQLREQGYTDDLDALLIAEPSQNGMFYAHKG
SMHFELTSRGKSAHSSMPELGINAITPVVNFIYHLNEAFQHVHERNHIIGPPTMASTVIQ
GGDQVNSIPDKATALFNVRTVTEYNSQSFMALFQSIQERVSDDHHRLTLQAYGDRSPVVT
TGENRLVNLAQDISEKYFGEKVKKIASTGVTDASLLLKDKDIHFPFITFGPGETSQAHQV
DEYVQKDVYLTFIQLYQEMFTTYLNDEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttttaagttcagatgaaaaaattcaaattttacgtgacatcatcgaaatccag
tcagttaacgattatgaggttgaagtggctcagtatttaaaaaatttgtttgataaatat
caaattaatgctcaaattttaaaactagaaaatagtgagacacgtgcgaacttagtagca
gaaattggctcagggcaccccgttcttggtgtttcaggtcatatggatgtagtgaatgta
ggagatataacaacatggcaatatgaaccatttcagctaacggaggatgaagatggccga
ttacatggtcgtggcacagcggatatgaaagcaggtctcgcagcactcgtaataagtatg
attgaaattaaagaagcgggattattgaagaaagggacgattcgtctattagcaacggct
ggtgaagaaattgccagtgaaggggcagcgcaattaagagaacaaggttatactgatgat
ttggatgctttattgattgcagaaccttcacaaaatggtatgttttacgcacataaaggg
tctatgcatttcgaattaacatccagaggtaaatctgcgcacagctctatgccagagtta
gggatcaatgctattacacctgttgtaaactttatttatcatttgaatgaggcgtttcaa
cacgtccatgaacgtaatcatatcataggcccgccaacaatggcctctacggttatccaa
ggtggggatcaggtgaactctattccagacaaagcaacagccttattcaatgtacggacg
gtgacagaatacaatagtcaaagttttatggcgttatttcaatcgattcaagaacgtgta
agcgatgatcaccatcgtctcacactccaagcatatggggaccgctcacctgttgtcact
acaggagaaaatcgtctggttaaccttgcgcaagatatcagcgaaaaatactttggcgaa
aaagttaaaaagattgcttcaacgggggttacggacgcatcgcttttattaaaagataaa
gatattcattttccatttataacctttggacctggtgaaacatcacaagcccatcaagtt
gatgaatatgtccaaaaagacgtttatttaacttttattcagttatatcaggaaatgttt
acaacttatttgaatgatgaaaaataa

DBGET integrated database retrieval system