KEGG   Candidatus Profftella armatura: SSDC_01365Help
Entry
SSDC_01365        CDS       T02777                                 

Gene name
gdhA
Definition
Glu/Leu/Phe/Val dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
ssdc  Candidatus Profftella armatura
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssdc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SSDC_01365 (gdhA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSDC_01365 (gdhA)
   00330 Arginine and proline metabolism
    SSDC_01365 (gdhA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SSDC_01365 (gdhA)
Enzymes [BR:ssdc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     SSDC_01365 (gdhA)
Exosome [BR:ssdc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SSDC_01365 (gdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(340993..342285)
Genome map
AA seq 430 aa AA seqDB search
MSKFTDNSRPSYLSQNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEH
DNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKG
GIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNY
TIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAA
NLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIP
CDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGV
IVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFNAIWELANTKKVSLRTAAFIIGCTRVL
QAHKTRGLYV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatttacagataattctagaccatcttatctttcacaaaatgatcttgggcca
tggggtgtttatttacagcaaattgatcgtgttaccccatatcttggttctctatctcgc
tggatagagatattgaaacatccaaaaaaaattttaatagtagatgttccaattgagcat
gataatggagaagtttttcattacgaaggatatcgtgtgcaacataatatattacgtggt
cccggaaaaggtggggtacgttttcatccggatgttacattatctgaaataattgcttta
tctggctggatgacaataaaaaatgctgcggttaatataccttatggcggagcaaaggga
ggaattcgtgttaatccaaaaaatttatcaaataatgaattaatgcgattaacacgtcgt
tatactaatgaaattagctctataattggattaaataaagatataccagcgcctgatgtt
ggaactgatatgcagattatgtcatggatgatggatacttattcaacaaaaaaaaattac
actataccaggtattgttacaggcaaaccaatctctattgggggtagttttggtagacaa
aaagcaactgggcgcggtgtatttattattggtagtaaaattgcttctaaaataaattta
aatattattaactctaaaatttctatacaagggtttggtaatgtaggtagtgttgcggca
aatcttttttttaaagctggcgcaaaaattgtggcaatacaggatgataaaacaacaatt
tataatccaaatggatttaatatacctaagttacaaaaatatgttactttcacaagaagt
ataaaagattttaatgagggtgaaaaaattaatgattctaaagaattttggtctattcca
tgtgacatattgattccagctgcgattgaagatcaaattaccattaataatgcaaataat
gttacagcaaaaattatattagaaggagctaatggaccaacaacaacagaagcggatgat
attttgcgagataaaggaataatattagcgccagacgttattactaatgccggaggtgta
attgttagttattttgagtgggtacaaaatctttctaatttattatggacagaacaagaa
attaatttaagattaaataatattatatgtaatgcatttaatgctatatgggaattagct
aacacaaaaaaagtatcattacgtaccgctgcgtttataataggttgtacgagagttttg
caagcacacaaaacaagaggattatatgtatag

DBGET integrated database retrieval system