KEGG   Shewanella sediminis: Ssed_0088Help
Entry
Ssed_0088         CDS       T00596                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sse  Shewanella sediminis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sse00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(97042..98034)
Genome map
AA seq 330 aa AA seqDB search
MSIALEPQANIQNDAPGMSFSSERNLDSTEQQTMWSQVTESVIKIDDISLAYSFIEHPKS
QKAIVISSGRIESYIKYRELIFDLYRQGYSIYALDHRGQGLSSRTTNNPQQGHIDRFETY
IDDFTHFIDVVVKKKNYKDLFLVGHSMGGTIGTLYMEKHPDTFRAAAFSAPMYGIKLPIS
RRFIRWLAQLLDTTDSDKGPNYVLGGGDYEAVEFAKNDLTNCQLRYDNYKKLYLQHPQVQ
VGSPTNRWLHESIDAAERAISAARNSQMPILILQADEDTVVDNFAQYHAVGGLCQLINIP
HARHEVFMEQDESRNMALTELVNFLQAHAS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatagccctcgagccacaagctaatattcaaaacgatgcccccggaatgagtttc
tcatccgagcgaaaccttgactcaacagagcaacagacaatgtggtcacaggttactgaa
tcggtcatcaaaattgatgatatcagcttagcttattcgtttatcgagcatccaaaaagc
cagaaagccatagtgatcagcagtggccggatcgagtcatacattaaataccgggaactt
atcttcgatctctatcgccagggctatagcatctacgcccttgatcatcgcggacaaggc
ctgtcgagcagaaccacaaacaatccccaacagggacatatagacagattcgagacctat
attgatgactttactcactttatagatgtcgtcgttaagaaaaaaaattataaggaccta
tttctggtgggtcactctatggggggtaccataggcaccctctacatggagaagcaccca
gataccttcagggctgccgccttttcagcccccatgtacggcatcaagttgcccataagt
cgccgatttatccgctggctggcgcagttgctcgacaccacagattcagacaaagggcct
aactatgtgctggggggaggtgactatgaagccgttgagtttgccaaaaatgacctgact
aactgccaacttcgctatgacaattacaagaagttgtacctacaacacccacaggtgcag
gtgggctcaccgaccaaccgctggttacatgagtctatcgatgcggctgagcgggcaatc
tcagcggcacggaatagccagatgcccatcctaatcctccaggccgatgaggacacggtt
gtcgataacttcgctcaatatcacgccgttggcggactctgccaactcattaatattccc
catgcacgtcatgaggtttttatggagcaggatgagagcagaaatatggcattaactgaa
ctggttaacttcctacaggcccatgcttcttaa

DBGET integrated database retrieval system