KEGG   Shewanella sediminis: Ssed_0088Help
Entry
Ssed_0088         CDS       T00596                                 

Definition
(GenBank) Lysophospholipase
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
sse  Shewanella sediminis
Pathway
sse00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ssed_0088
Enzymes [BR:sse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Ssed_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Esterase LIDHydrolase DLH Peptidase_S28 DUF915 Abhydrolase_5 PGAP1 LCAT Lipase_3 DUF900
Motif
Other DBs
NCBI-ProteinID: ABV34701
JGI: Ssed0088
UniProt: A8FPC8
Position
complement(97042..98034)
Genome map
AA seq 330 aa AA seqDB search
MSIALEPQANIQNDAPGMSFSSERNLDSTEQQTMWSQVTESVIKIDDISLAYSFIEHPKS
QKAIVISSGRIESYIKYRELIFDLYRQGYSIYALDHRGQGLSSRTTNNPQQGHIDRFETY
IDDFTHFIDVVVKKKNYKDLFLVGHSMGGTIGTLYMEKHPDTFRAAAFSAPMYGIKLPIS
RRFIRWLAQLLDTTDSDKGPNYVLGGGDYEAVEFAKNDLTNCQLRYDNYKKLYLQHPQVQ
VGSPTNRWLHESIDAAERAISAARNSQMPILILQADEDTVVDNFAQYHAVGGLCQLINIP
HARHEVFMEQDESRNMALTELVNFLQAHAS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatagccctcgagccacaagctaatattcaaaacgatgcccccggaatgagtttc
tcatccgagcgaaaccttgactcaacagagcaacagacaatgtggtcacaggttactgaa
tcggtcatcaaaattgatgatatcagcttagcttattcgtttatcgagcatccaaaaagc
cagaaagccatagtgatcagcagtggccggatcgagtcatacattaaataccgggaactt
atcttcgatctctatcgccagggctatagcatctacgcccttgatcatcgcggacaaggc
ctgtcgagcagaaccacaaacaatccccaacagggacatatagacagattcgagacctat
attgatgactttactcactttatagatgtcgtcgttaagaaaaaaaattataaggaccta
tttctggtgggtcactctatggggggtaccataggcaccctctacatggagaagcaccca
gataccttcagggctgccgccttttcagcccccatgtacggcatcaagttgcccataagt
cgccgatttatccgctggctggcgcagttgctcgacaccacagattcagacaaagggcct
aactatgtgctggggggaggtgactatgaagccgttgagtttgccaaaaatgacctgact
aactgccaacttcgctatgacaattacaagaagttgtacctacaacacccacaggtgcag
gtgggctcaccgaccaaccgctggttacatgagtctatcgatgcggctgagcgggcaatc
tcagcggcacggaatagccagatgcccatcctaatcctccaggccgatgaggacacggtt
gtcgataacttcgctcaatatcacgccgttggcggactctgccaactcattaatattccc
catgcacgtcatgaggtttttatggagcaggatgagagcagaaatatggcattaactgaa
ctggttaacttcctacaggcccatgcttcttaa

DBGET integrated database retrieval system