KEGG   Shewanella sediminis: Ssed_0380Help
Entry
Ssed_0380         CDS       T00596                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sse  Shewanella sediminis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sse00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(444582..445241)
Genome map
AA seq 219 aa AA seqDB search
MTSKDAVLSESAQLVQSALLTRGLETPMLPSELSADERKDQIEQHMRAILNLMSLDLTDD
SLADTPRRIAKMYVDEIFSGLDYQNFPKITVIENKMGFDEMIKVNDISLTSTCEHHLVTI
DGLATVAYLPRKNIIGLSKINRIVQFFAQRPQVQERLTQQVLVALQTLLETKDVAVKMDA
VHYCVKSRGVMDSTSSTTTTALGGIFKSNPATRAEFLSN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagacgccgttctcagtgaatcagcacagcttgtgcaaagtgcattatta
acacgtggactcgagactcctatgctcccaagtgagcttagcgccgatgagcgtaaagac
cagattgaacagcatatgcgtgcaatcttaaatttaatgtcgctggatctgaccgatgac
agcttggccgatacaccacgccgtatagccaaaatgtatgtcgatgaaattttctcaggt
ctggattatcagaatttccccaagatcactgtcatcgaaaataagatgggattcgatgag
atgatcaaggttaacgatatcagcctgacgagtacctgcgaacaccacttggtcaccatt
gatggtttagccaccgtggcttatctgccaagaaaaaacatcataggcctgtctaagatc
aatcgtatcgtgcaattcttcgcacaacgtcctcaggtgcaggagcgactcactcaacaa
gttttagtcgcattgcagaccctgctagagaccaaagatgtcgcagtaaagatggatgcc
gtacattattgtgtgaaatcccgtggcgtcatggactccaccagctcaacgacaactacg
gcactgggtggcattttcaaatcgaacccagccacacgcgccgaattcttaagtaattaa

DBGET integrated database retrieval system