KEGG   Shewanella sediminis: Ssed_0894Help
Entry
Ssed_0894         CDS       T00596                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sse  Shewanella sediminis
Brite
Enzymes [BR:sse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ssed_0894
Secretion system [BR:sse02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ssed_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1067490..1068227
Genome map
AA seq 245 aa AA seqDB search
MKFTRAFSLILAVVLAPFAAAAPNTQSNTIANSAELKQKLTETLSVEVHSLQQSPIPGLY
EALTDRGVLYISKDGSKLFHGSLYDLDKGMKNLTEAAMAGPRMKMIKPLEDNMLVYKAKN
EKHVVTVFTDISCGYCRKLHNQMDEYNDLGITVRYLAFPRRGVPSANADEMEAVWCAADP
LTAMTEAKAGKSIKTAKCDAKIAEQYHLGQSLGINGTPAIILEDGSMIPGYQPPKDLLRV
LESTN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttacccgagcattttctttgattttagctgtggtattagccccttttgctgct
gccgcaccgaatactcaatccaatactattgctaacagcgcagagctaaaacaaaaatta
actgagaccttaagcgtcgaagtacattcgcttcagcagtcacccattccaggtttatat
gaagctttaaccgaccgcggtgtgctttatatctctaaagatggttctaaactgtttcac
ggcagcttatacgatctagacaaagggatgaaaaacctgaccgaggcggccatggcgggt
cctcgtatgaagatgattaagccactcgaagataatatgttggtctataaggctaaaaac
gagaagcatgtcgtcaccgtatttaccgatatcagctgtggatattgccgtaagttacac
aatcagatggatgagtataacgacttaggcattaccgtgcgctatcttgctttcccgcgt
cgcggcgtcccatctgccaatgccgatgagatggaagcggtatggtgtgcagccgatcct
ctgactgccatgaccgaggcaaaggctggtaagagcattaagacggcaaaatgtgatgca
aaaattgcagagcaatatcatcttggacagagcctgggtattaacggtacgccggcaatt
atcttagaagatggcagcatgatcccgggctaccaaccacctaaagatctactgcgagta
ttagaatcgaccaattaa

DBGET integrated database retrieval system