KEGG   Shewanella sediminis: Ssed_1009Help
Entry
Ssed_1009         CDS       T00596                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sse  Shewanella sediminis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ssed_1009
   00240 Pyrimidine metabolism
    Ssed_1009
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Ssed_1009
   03430 Mismatch repair
    Ssed_1009
   03440 Homologous recombination
    Ssed_1009
Enzymes [BR:sse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Ssed_1009
DNA replication proteins [BR:sse03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Ssed_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1199797..1200267)
Genome map
AA seq 156 aa AA seqDB search
MTQTLFYLMPTEPRSSGTALEQMYHLACELAQQAFMQQQLVYLHCQDREQAYAIDELLWQ
FEPRSFVPHNLKGEGPTTGAPVEIGFDKLGPNKNRHLLINLADQVPSFAVNFGQIIDFVA
NDTSHKAIARDRYRQYRSLGVTLNTQDLAKQPLNLV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaccctattttatcttatgccaactgagcctcgaagctcgggaacggcatta
gagcagatgtatcatctggcttgtgaactggctcagcaggcatttatgcagcagcaactg
gtttatcttcactgccaggatagagagcaggcctatgccatcgatgaacttttatggcag
tttgaaccgcgctctttcgttccccataatttgaaaggggaaggacccaccaccggtgct
ccggttgaaatcggcttcgataagctgggtcccaataaaaatcgtcatcttctgattaat
cttgcagaccaagtcccctcatttgcggtaaactttggtcagattatcgatttcgttgcc
aacgataccagccataaagcgatcgcccgcgatcgatatcggcagtatcggagcctggga
gttacattgaacacccaggatttagcaaaacaaccacttaatttagtttga

DBGET integrated database retrieval system