KEGG   Shewanella sediminis: Ssed_1079Help
Entry
Ssed_1079         CDS       T00596                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sse  Shewanella sediminis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sse00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1280365..1280862
Genome map
AA seq 165 aa AA seqDB search
MSARVFISLGSNIEPQRYLKAALSELSYHFGALTLSSVYDSEAVGFDGSNFLNMVVAVDT
CLSISEVVTLFKRIERDNGRLVGAKKFAPRTLDLDLLLYDDVVTQEPVELPRAEITKNAF
VLWPMAEVAPDLLHPLLARSYQALWDEYDKTEQKLWPVPFAWAPS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgcgagtctttatcagtttaggaagtaatattgaacctcagcgttaccttaag
gctgccttaagtgagcttagctatcattttggggcgctcacactctcatcagtttatgac
agtgaagccgtcggtttcgatggcagtaacttcttgaatatggttgtcgcggtcgatacc
tgtttgagtatttctgaggtcgttactctgtttaaacgaatagagcgggataatggtcgt
ctggttggggccaagaagtttgcacccaggacattagatctcgatctgcttctttatgat
gatgttgtgactcaggaacctgtcgagcttccaagagccgaaatcaccaagaatgcattt
gtgctctggcccatggctgaggttgccccggatctgttacatcccctgttagcgcgaagc
tatcaagctttgtgggatgaatatgataaaacggagcaaaaactttggccggttccgttt
gcctgggcaccgtcttaa

DBGET integrated database retrieval system