KEGG   Shewanella sediminis: Ssed_1089Help
Entry
Ssed_1089         CDS       T00596                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sse  Shewanella sediminis
Pathway
sse00240  Pyrimidine metabolism
sse00250  Alanine, aspartate and glutamate metabolism
sse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ssed_1089
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ssed_1089
Enzymes [BR:sse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Ssed_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABV35700
JGI: Ssed1089
UniProt: A8FS77
Position
complement(1291868..1292887)
Genome map
AA seq 339 aa AA seqDB search
MTQFQGSHILSVNQLNLDAVQQIFNVAARMAPYALRQKRTTVLEGAILGNLFFEPSTRTR
ISFGCAFNLLGGKVNETVGMASSSLSKGESLYDTARVLSSYSDVIAMRHPEAFSVREFSE
GSRVPVINGGDGSNEHPTQALLDLFTIQKELATRGQDISGMHIAMVGDLKFGRTVHSLSR
LLCMYKNVSFTLVSPKELAMPDYVISDIENAGHKITITDQLEGNLDQADILYLTRIQEER
FPSQEEANKYRGKFRLNRNIYTKHCKSNTVIMHPLPRDSRKQANELDNDLNSHPNLAIFR
QADNGLLIRMALFALTLGVDAQLEKYECPVNWYSRKADF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtttcaaggatcacatatcctctcggtaaaccagcttaacctggatgccgtc
caacagatattcaatgttgccgcccgcatggccccctatgctttaagacagaaacgtaca
actgtcctcgaaggcgcgattttaggtaacctttttttcgagcccagcacacgaacgcgt
atcagtttcggctgcgcctttaacttgctcggtggaaaggttaacgaaaccgttggtatg
gcctcttcatcactgtctaagggggaatccctctatgacacggcgagagtgctatcgagt
tactcggatgtaatcgccatgcgtcaccctgaagcgttctcggtcagagagttctctgaa
ggcagccgggtcccggttatcaatgggggggacggctctaacgagcatccgacccaagct
ctgctcgatctgtttaccattcaaaaagagctcgccacacgcggccaggatatcagtgga
atgcatatcgccatggtgggagacctgaaattcggccgtacggttcactcgctctctcgt
ctgctatgtatgtataaaaacgtaagttttacactggtttcaccgaaagagttagcaatg
cctgactatgtgatcagtgacattgaaaatgctgggcataagatcacaataacagaccaa
cttgaaggcaatttagatcaggctgatatactctacctgactcgcattcaagaagagcgt
tttccttcacaagaagaagcgaacaagtatcgcggtaagtttcgtcttaatcgcaatatt
tacacaaagcattgcaagtcaaacactgtgatcatgcatccgctacctagagactcgcgc
aagcaggccaacgaactggacaatgaccttaatagtcatcctaatttggccatctttaga
caggcagataacggactcctgatccgcatggcactgtttgccctgacactcggcgttgat
gcgcaactcgaaaaatatgagtgtccggttaattggtattcacgaaaagccgacttttaa

DBGET integrated database retrieval system