KEGG   Shewanella sediminis: Ssed_1177Help
Entry
Ssed_1177         CDS       T00596                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sse  Shewanella sediminis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ssed_1177
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ssed_1177
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ssed_1177
Enzymes [BR:sse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ssed_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1399502..1400782
Genome map
AA seq 426 aa AA seqDB search
MELYNLKHPQQVVNFTQALKLGLGKDRGLFFPKQIPVLDDIEALLAMPFVERCKKVLGAW
LSSELGQDRVDTLVEKAFNFELSLAKADDKRYCLELFHGPTLAFKDFGARFMAQCLNELA
SDEKISILTATSGDTGAAVADAFFGLDNIQVVVLYPKGKISLLQEKMFTTLGDNIHTVSV
ESDFDACQDLVKRAFEDSDVRDGLHLNSANSINISRLLAQICYYFEAVAQFKREHKQDPV
IAVPSGNFGNLTAGLFAKAMGLPVKRFVAATNSNDTVPRYLDQGDWLPHATVATMSNAMD
VAEPSNWPRVEAIVDAMSWSLSDITGVALSESDTSEALKELNRAGYLSEPHAAIAAQALT
LTMSDDDKGIFLGTAHPAKFKEVVESELSIEVPLPPALAAVADKDILSATLEADFTELKS
HLFKVL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtataacctaaaacacccgcagcaggtggtgaattttacccaagccctgaag
ttaggtctgggaaaagacagaggacttttttttccgaagcagatcccggttttggatgac
atagaagcacttttagcaatgccttttgttgaacgctgcaaaaaagtactcggtgcatgg
ttatcatcagagcttggtcaggacagggtggataccttagttgagaaagcctttaacttt
gagctctctctcgctaaagccgacgacaaacgatactgcctcgagttgtttcatggtcca
acattagcatttaaagactttggcgcacgatttatggcgcagtgtttgaacgaactcgcg
tcagatgaaaaaattagtattctaactgcaacctcaggcgataccggggcggccgttgcc
gatgcattctttggtttggataatatccaagttgtggttttgtatcctaaaggcaagatc
agtttactgcaggaaaagatgtttaccaccttgggtgacaacatacacacagtatcggtt
gagtcagactttgatgcttgtcaggacttagttaagcgagcgttcgaagatagcgatgtt
cgtgacggtttgcatctgaactcggctaactccatcaatattagtcgcctgcttgcccag
atctgttattactttgaggccgtcgctcaatttaaacgtgagcataagcaagatcctgtg
attgctgtgcccagtggtaactttggtaacttaacggcgggattgttcgccaaggcgatg
gggttgcccgtcaaacgctttgttgccgcgactaacagcaatgacaccgtaccacgttat
ttagatcaaggtgattggcttcctcatgcaaccgttgcaaccatgtctaatgcaatggat
gtcgcagagcctagtaactggccaagagtggaagcgatagtggatgccatgagctggtcg
ctatccgatattaccggtgttgctttatctgagtcagatacctctgaggctcttaaagag
ttaaatcgtgcaggctatctttctgagcctcatgcagcaatcgcggctcaagcgcttact
ttgactatgtccgatgatgataaaggcatattcttgggtacggctcacccagctaagttt
aaagaggtggttgagagtgagctcagtattgaggtgccacttcctccggctttagccgct
gtcgctgacaaagacattttgtcggcaacattagaggctgattttacagagttgaaatct
cacctatttaaggtgctgtag

DBGET integrated database retrieval system