KEGG   Shewanella sediminis: Ssed_1414Help
Entry
Ssed_1414         CDS       T00596                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sse  Shewanella sediminis
Pathway
sse00620  Pyruvate metabolism
sse00630  Glyoxylate and dicarboxylate metabolism
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01120  Microbial metabolism in diverse environments
sse01200  Carbon metabolism
Module
sse_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ssed_1414
   00630 Glyoxylate and dicarboxylate metabolism
    Ssed_1414
Enzymes [BR:sse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ssed_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABV36025
JGI: Ssed1414
UniProt: A8FT52
Position
1676315..1678033
Genome map
AA seq 572 aa AA seqDB search
MTHEVTDNRQNDSTLASSAFEHQMFKESTATRTSETEMDIRDRLTIKGGHVEGQEQVFTE
GAMSLLELLCKQFASQVPQLLSNRVKKQALIDAGELPNFLPQTRAIRDGDWQIRGIPQDL
TDRRVEITGPVERKMIINALNANVKVFMADFEDSLAPSWNKVVEGQINLRDAVRGEIEYT
SPETGKHYRLNDSPAVLICRVRGLHLLEKHVEFDASSIPASLFDFALYFYNNYRQLLTKG
SGPYFYLPKLESHEEARWWAKVFAFVEDRFCLQPGTIKCTCLIETLPAVFEMEEILYELR
SNIVALNCGRWDYIFSYIKTLKNHPDRILPDRQAVTMDKSFLSAYSRLLVKTCHKRGALA
MGGMAAFIPAKESEMNREVLEKVRRDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGED
HVNQLHITRDVDAPIHARDLLLPCEGERSEAGMRVNIRIALQYIESWINGNGCVPIYGLM
EDAATAEISRTSIWQWIKHEQKLSNGALVTNVLFKEMLVEELANVKLEVGAERFTHGSFT
QAAVLLEKITTSDELVDFLTLPGYEMLTGQFG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgaagtaaccgacaacagacagaatgattcaacgcttgcatcatcggcattt
gaacatcagatgttcaaagagagcactgccacccgcacctctgagacagagatggatata
agagataggcttaccattaaaggggggcatgtcgaggggcaagagcaggtttttaccgag
ggggccatgagtctgctcgaattgctgtgtaaacagtttgcctcgcaagtgccacagctt
ctttcaaaccgagtgaaaaagcaggcgttaatcgatgccggtgaattgccaaactttctg
ccacagacccgcgcgataagagatggtgattggcagatccgtgggatcccacaagattta
accgacaggcgtgtcgagatcaccggacctgtcgagcgcaagatgatcatcaatgccttg
aatgccaatgtgaaggtatttatggccgattttgaggattcattggcgccgagttggaat
aaggtggttgaggggcagattaacctgcgtgatgcggtgcgcggtgaaattgaatacacc
tcgccagagacaggcaagcattatcgactcaatgattcccctgcggtattgatctgtcgc
gttcgtggtttgcacttgctcgaaaagcatgtggagtttgacgcgtcgagtatccctgca
tccctgttcgattttgccctctatttttacaataactatcgacaacttttgacaaaaggc
agtggcccctatttttatctccccaaattagagagtcatgaggaagcccgctggtgggcc
aaggtgtttgccttcgtcgaagatcgtttctgcctgcagccaggcacgattaagtgtacc
tgcctgattgagacgctgcccgcagtgttcgagatggaggagatcctctatgagctgaga
tcgaacatagtggcgcttaattgcggccgctgggactacattttcagctatatcaaaaca
ttaaagaatcatccggatcgtattctgcccgacaggcaagccgtgaccatggataagtca
tttttaagcgcttattcacggttattggttaagacctgccataagcgcggcgctttggcc
atggggggaatggctgcatttattcctgccaaagagagcgaaatgaatcgagaggtgctt
gaaaaggtacgcagagataaagagctcgaggcgagaaatggacacgacggcacttgggtg
gcacatccgggcttagccgataccgccatggggatcttcaatgagtatataggtgaggat
cacgttaaccagttacatatcactcgtgatgtggatgcgcccattcacgccagagatctg
ctgttgccctgtgagggagagcgctccgaggccgggatgcgggtcaatatccgcatcgca
ttgcaatatatcgagtcctggataaatggcaatggatgtgtccctatctatggcctgatg
gaagatgcggccaccgccgagatatcacgaacttcaatctggcagtggataaaacacgag
cagaaactctctaatggggctttggtgactaacgtcctgttcaaggagatgttagtggag
gagctggctaacgtgaagcttgaggtgggtgcggagcggttcacccatggcagctttact
caggcggcagtcctgctcgagaagatcaccacctccgatgagcttgtcgatttcctgact
ctaccgggatatgaaatgttaaccggccaattcggctaa

DBGET integrated database retrieval system